KEGG   Ketogulonicigenium vulgare WSH-001: KVU_0607Help
Entry
KVU_0607          CDS       T01909                                 

Gene name
trpC
Definition
(RefSeq) indole-3-glycerol phosphate synthase protein
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
kvl  Ketogulonicigenium vulgare WSH-001
Pathway
kvl00400  Phenylalanine, tyrosine and tryptophan biosynthesis
kvl01100  Metabolic pathways
kvl01110  Biosynthesis of secondary metabolites
kvl01130  Biosynthesis of antibiotics
kvl01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:kvl00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    KVU_0607 (trpC)
Enzymes [BR:kvl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     KVU_0607 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS NanE
Motif
Other DBs
NCBI-GeneID: 12373459
NCBI-ProteinID: YP_005794442
UniProt: F9Y3T2
Position
complement(656837..657646)
Genome map
AA seq 269 aa AA seqDB search
MTNILDQIKAYKLEDVAARKAAVPLAEVEAKARAASKPRGFAESLRTASIEGYGLIAEIK
KASPSKGLIRPDFDPPALAKAYADGGATCLSVLTDTPSFQGEDSFLTAAREACDLPALRK
DFIYDTYQIAESRALGADCILLIMASLEDGQAAELEAAAFDWGMDVLIEVHDEEELERAA
LLKSPLMGINNRSLKTFEVTLDTTRRLARMVPPDRMIVAESGIFTPADMADIARYGARCF
LVGESLMRQDDVATATRTLLANPYMGENA
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgacgaatattctggaccagatcaaagcctataaactcgaggatgtcgccgcccgcaaa
gccgccgttccgctggccgaggtcgaggcaaaggcccgcgccgccagcaaaccgcgcggc
tttgccgaaagcttgcgcacggcgtccatcgagggttacggcctgatcgcggaaatcaaa
aaagccagcccctccaagggcctgatccgtcccgatttcgatccgcccgcgctggcaaag
gcctatgccgatggcggtgcgacctgcctttcggtgctgaccgacacgcccagctttcag
ggcgaggacagtttcctgaccgccgcgcgcgaggcctgcgatctgcccgcgctgcgcaag
gatttcatctatgacacctatcagatcgccgaatcccgtgcgctgggggccgattgcatc
ctgctgatcatggcgtctttggaagatggtcaggcggctgaactcgaggctgccgccttt
gactggggcatggatgtgctgatcgaagtgcatgacgaggaagagctggaacgcgcggcc
ttgctgaaatcgccgctaatgggcatcaacaaccgcagcctgaagacattcgaggtcacg
ctcgacaccacgcgccgccttgcgcgcatggtgccgcccgaccggatgatcgtcgcggaa
tcgggtattttcacgcccgccgatatggccgatatcgcccgttatggcgcgcgctgtttt
cttgtcggtgaaagcctgatgcgccaagatgatgtggcaaccgccacgcgcacgctgctg
gcgaacccctatatgggcgagaatgcctga

DBGET integrated database retrieval system