KEGG   Ketogulonicigenium vulgare WSH-001: KVU_0851Help
Entry
KVU_0851          CDS       T01909                                 

Definition
(RefSeq) Guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
kvl  Ketogulonicigenium vulgare WSH-001
Pathway
kvl00230  Purine metabolism
kvl01100  Metabolic pathways
Module
kvl_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:kvl00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    KVU_0851
Enzymes [BR:kvl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     KVU_0851
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_16 AAA_22 AAA_18 MMR_HSR1 RsgA_GTPase Helveticin_J
Motif
Other DBs
NCBI-GeneID: 12373712
NCBI-ProteinID: YP_005794686
UniProt: F9Y558
Position
898302..898979
Genome map
AA seq 225 aa AA seqDB search
MTDMTTPRQAAPRQGLLIILSSPSGAGKSTLSRRLMAWDETLRFSVSATTRAPRAGEVDG
EHYHFMTRDGFGQLIATDQMLEHAEVFGNYYGSPRGPVEMAMAQGRDTLFDIDWQGGQQI
RNSPLGAAVVSIFILPPSIAELESRLRARAQDSEEVIAKRMRESMNEISHWAEYDYVLVN
EDLDQAEAQLITIIQAERARRSRQPWLNGFTRGLQQEFTLRGTSS
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacatgaccacgccgcgccaagccgccccgcgtcaggggcttttgatcatcttg
tcctcgccttcgggcgcgggaaaatcgacgctgtcgcgccgtctgatggcctgggatgag
acgctgcgattctcggtctcggccacgacgcgtgcgccgcgggcgggcgaggtggatggc
gaacattaccatttcatgacgcgcgacggctttggccagttgatcgccaccgatcagatg
ctggagcatgccgaggtctttggcaattattacggcagcccgcgcggtccggtggaaatg
gcgatggcgcagggccgcgatacgctgttcgacatcgactggcagggcgggcaacagatc
cgcaactcgccgctgggggcggctgttgtgtcgattttcatcctgcctccctcgattgcc
gagctggaaagccgtctgcgcgcgcgcgcgcaagacagcgaagaggtgatcgcgaaacgt
atgcgcgaaagcatgaacgaaatcagccattgggcggaatacgattacgtgctggtcaac
gaggatctggatcaggccgaggcgcagctgatcaccatcattcaggccgaacgcgcccgt
cgcagccgccaaccttggctgaatggctttacgcgcggtcttcagcaggaatttacattg
cgtggcacgtcgtcataa

DBGET integrated database retrieval system