KEGG   Ketogulonigenium vulgarum: KVU_0851Help
Entry
KVU_0851          CDS       T01909                                 

Definition
Guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
kvl  Ketogulonigenium vulgarum
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:kvl00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
898302..898979
Genome map
AA seq 225 aa AA seqDB search
MTDMTTPRQAAPRQGLLIILSSPSGAGKSTLSRRLMAWDETLRFSVSATTRAPRAGEVDG
EHYHFMTRDGFGQLIATDQMLEHAEVFGNYYGSPRGPVEMAMAQGRDTLFDIDWQGGQQI
RNSPLGAAVVSIFILPPSIAELESRLRARAQDSEEVIAKRMRESMNEISHWAEYDYVLVN
EDLDQAEAQLITIIQAERARRSRQPWLNGFTRGLQQEFTLRGTSS
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacatgaccacgccgcgccaagccgccccgcgtcaggggcttttgatcatcttg
tcctcgccttcgggcgcgggaaaatcgacgctgtcgcgccgtctgatggcctgggatgag
acgctgcgattctcggtctcggccacgacgcgtgcgccgcgggcgggcgaggtggatggc
gaacattaccatttcatgacgcgcgacggctttggccagttgatcgccaccgatcagatg
ctggagcatgccgaggtctttggcaattattacggcagcccgcgcggtccggtggaaatg
gcgatggcgcagggccgcgatacgctgttcgacatcgactggcagggcgggcaacagatc
cgcaactcgccgctgggggcggctgttgtgtcgattttcatcctgcctccctcgattgcc
gagctggaaagccgtctgcgcgcgcgcgcgcaagacagcgaagaggtgatcgcgaaacgt
atgcgcgaaagcatgaacgaaatcagccattgggcggaatacgattacgtgctggtcaac
gaggatctggatcaggccgaggcgcagctgatcaccatcattcaggccgaacgcgcccgt
cgcagccgccaaccttggctgaatggctttacgcgcggtcttcagcaggaatttacattg
cgtggcacgtcgtcataa

DBGET integrated database retrieval system