KEGG   Ketogulonicigenium vulgare WSH-001: KVU_0885Help
Entry
KVU_0885          CDS       T01909                                 

Gene name
speB
Definition
hydrolase arginase family protein (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
kvl  Ketogulonicigenium vulgare WSH-001
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kvl00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    KVU_0885 (speB)
Enzymes [BR:kvl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     KVU_0885 (speB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
932037..932996
Genome map
AA seq 319 aa AA seqDB search
MALEDAKTQVDQAFTRQSLRGLSHENAFGGAVSFLRRRYSKDLSGVDLAVTGVPFDQAVT
HRTGPRFGPRALREASTLQPYDPPYGWGYDPLSTLSVVDYGDLAFDYAKTAAFPGALTEH
IRGILAAGAGSITLGGDHFITLPILRAYAEKFGPLSVIHFDAHSDLWQDDDPDRIDHGTF
MYKAVREGLVDVSRSLQIGIRTECDDYLGMPYIDARTVHEKGATWVVEQAKSAVGDHPVY
ITFDIDALDPAFAPGTGTPVWGGLASWQAAAILRDLAGINLIGGDVVEVSPPFDPTGATA
VAGAHVAMELIALYGWTRR
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atggcactcgaggacgccaaaacccaggttgatcaggcgtttacgcgccaatctttgcgc
ggcctctcgcatgagaatgcctttggcggggcggtgtctttcctgcgccgccgctatagc
aaggacttgagcggcgtcgatctggccgtgaccggcgtgccctttgatcaggccgtcacg
catcgcaccggcccccgtttcgggccgcgggcgctgcgcgaggcttcgaccttgcagccc
tatgatccgccctatggctggggttatgatccgctatcgacgctgtcggtggtggattac
ggcgatctggcgttcgattacgcgaaaacggcggccttcccgggcgcgttgaccgaacat
attcgcggtattctggcggcgggcgcaggcagcatcacgctgggcggtgaccactttatc
acgctgccgatcctgcgtgcctatgccgaaaagttcgggcccctgtcggtgatccatttc
gacgcgcattccgatctgtggcaggacgacgatccagaccgtatcgaccacggcacattc
atgtataaggccgtgcgcgaagggttggtcgatgtcagccgcagcctgcaaatcggcatc
cgcaccgaatgcgacgattatctgggtatgccctatatcgacgcgcgcactgtccatgaa
aagggcgcgacttgggttgtggaacaggccaaatccgccgtgggcgaccatcctgtatac
atcacattcgatattgatgcccttgatcccgcattcgcgccgggcaccggcacgccggtt
tggggtggtcttgccagttggcaggcggcggcgatcctgcgcgatctggcggggatcaat
ctgatcggcggtgatgtggtcgaggtctcgccccccttcgaccccacgggcgccaccgct
gtcgcgggcgcccatgtggcgatggagctgatcgccctttatggctggacgcgccgctaa

DBGET integrated database retrieval system