KEGG   Ketogulonicigenium vulgare WSH-001: KVU_0894Help
Entry
KVU_0894          CDS       T01909                                 

Gene name
tpiA
Definition
triosephosphate isomerase protein (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
kvl  Ketogulonicigenium vulgare WSH-001
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:kvl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    KVU_0894 (tpiA)
   01230 Biosynthesis of amino acids
    KVU_0894 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KVU_0894 (tpiA)
   00051 Fructose and mannose metabolism
    KVU_0894 (tpiA)
   00562 Inositol phosphate metabolism
    KVU_0894 (tpiA)
Enzymes [BR:kvl01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     KVU_0894 (tpiA)
Exosome [BR:kvl04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   KVU_0894 (tpiA)
  Exosomal proteins of bladder cancer cells
   KVU_0894 (tpiA)
  Exosomal proteins of melanoma cells
   KVU_0894 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(940699..941454)
Genome map
AA seq 251 aa AA seqDB search
MRRKIAAGNWKMFGTVADLSQIAAIATGADKAVDTLICPPATLIAAAAPHAAASFAIGGQ
DCHPLQSGAYTGEISALMLRDAGATHVIVGHSERRRDHAETNDLVRAKAGAALEAGLTAV
ICVGESLEQREAGITLDAITAELEASLPEGCVGGNTIVAYEPLWAVGTGLIPTPQQIAEV
HGRIRAILRARFGHEAEMIRILYGGSVKASNAAEIFAAADVDGALVGGASLKAADFLPII
AALAAAALVTA
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcgtaaaattgctgcgggtaactggaagatgtttggcacggtggcggatctgtcg
cagatcgcagccatcgccacgggcgccgacaaagctgtcgatacgctgatctgcccacct
gccacgctgatcgccgccgccgccccccatgccgcagccagcttcgccatcggcggtcag
gattgccacccgttgcaaagcggcgcctatacgggcgagatttcggccctgatgctgcgc
gacgcgggcgcaacccatgtcatcgtcggccattccgaacgccgccgcgatcatgccgag
accaatgaccttgtccgcgccaaagccggtgccgcattggaagcgggtctgaccgccgtg
atctgcgttggcgaaagcctcgagcagcgcgaagcgggcatcacattggacgccatcacc
gcagaactcgaggcctcgctgcccgagggatgcgtgggcggcaacaccatcgtcgcctat
gagccgctctgggctgtgggtaccggtctgatcccgacccctcagcaaatcgccgaagtg
catggccgcatccgcgctatcttgcgcgcgcgctttgggcacgaggccgagatgatccgc
atcctttacggcggctcggtcaaagcctcgaacgcggccgagattttcgcggccgccgat
gtcgatggcgcgctggtgggcggcgcgagtctgaaggccgcagacttcctgccgatcatc
gcggcgctcgcggctgcggcactggtcaccgcttaa

DBGET integrated database retrieval system