KEGG   Ketogulonicigenium vulgare WSH-001: KVU_1187Help
Entry
KVU_1187          CDS       T01909                                 

Gene name
glk
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
kvl  Ketogulonicigenium vulgare WSH-001
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:kvl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    KVU_1187 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KVU_1187 (glk)
   00052 Galactose metabolism
    KVU_1187 (glk)
   00500 Starch and sucrose metabolism
    KVU_1187 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    KVU_1187 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    KVU_1187 (glk)
   00524 Butirosin and neomycin biosynthesis
    KVU_1187 (glk)
Enzymes [BR:kvl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     KVU_1187 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1248376..1249323
Genome map
AA seq 315 aa AA seqDB search
MTTELSLVADIGGTNTRLALSAAGVVLHDTVRRFQNEGRQLNDILDEYLAECCPDTKPHS
ACFALAGPISGDTGRMTNLAWTIHAPEIATRTSANRCILINDLQAQGYALPALAPDQLTP
VLSAERDIRAPRLVVGLGTGYNAAFVLPIESGVLVPAAEAGHASLPAHTADGRKVVDWLL
ANLGQAQVEDALSGTGFAHIHAALHGEKATPPALLARCEDGEAKALKTLEVAIELLGGVV
GDLALIFLPRGGIYLTGGFGQALTPWLRQPHLQTVFHDAFAAKGKISAIMQDFALSVIGD
DFAALEGCALRVAQN
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgacgactgaactctctcttgttgcggatatcggtggaacgaacacgcgcctcgcgcta
tcggcggcgggcgttgtgctgcatgatacggtgcgccgttttcagaacgaaggccggcag
ctgaatgatattctggatgaatatctggcggaatgctgccccgataccaaaccccacagc
gcctgtttcgcgctggccgggccgatcagcggtgatacgggccggatgacaaacttggcc
tggaccatccatgcgcccgagattgccacccgcacatcggcgaatcgctgcattttaatc
aatgacttgcaggcacagggctatgcgctgcccgcccttgcgcccgaccaactgacgccg
gtgctgtctgccgaacgcgacatccgcgcgccgcgtttggtcgtcggccttggcaccggc
tataacgccgcctttgtgctgccgattgaatcgggcgtgttggttcctgcggccgaggcg
ggccatgcctcgctgcccgcccatacggcggacggccgcaaggttgtcgactggcttttg
gcgaacctgggccaagcacaggtcgaggacgcgctatctggcaccggattcgcccatatc
cacgccgcgctgcacggcgagaaagccacgccccccgcgctgctcgcgcgctgtgaggat
ggcgaggcaaaggccctgaagacgctggaagtcgcgatcgagctgctgggcggggttgtg
ggtgaccttgcgctgatcttcctgccgcgcggcggtatctatctgaccggcggctttggg
caggccctgacgccctggctgcgccagccgcatctgcaaacggtctttcacgacgccttt
gccgccaagggcaagatcagcgccatcatgcaagatttcgcgctttcggtgatcggcgac
gatttcgccgccctcgaaggctgcgccttgcgcgtcgcgcagaactaa

DBGET integrated database retrieval system