KEGG   Ketogulonicigenium vulgare WSH-001: KVU_1414Help
Entry
KVU_1414          CDS       T01909                                 

Gene name
glgB
Definition
1,4-alpha-glucan branching enzyme (Alpha amylase protein) (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
kvl  Ketogulonicigenium vulgare WSH-001
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:kvl00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    KVU_1414 (glgB)
Enzymes [BR:kvl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     KVU_1414 (glgB)
Exosome [BR:kvl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   KVU_1414 (glgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1508467..1510500)
Genome map
AA seq 677 aa AA seqDB search
MPDAAAVFLCCDDGKTPMQQHPDAAGLWTATMPVAPSYRFEAHFLDGAVYGWQDAYRYGS
LFHDKWSQSPNGLRLWHSLGAHCVEVSGVKGTFFAVWAPNARRVSVVGDFNHWDGRRAPM
RLQHGCGIWEIFLPDVTADALYKFEVLGADGIMRLKADPYGQQAERAPGNASIVTMKSAF
AWTDKDWMTTRGSRHSPDAPISIYEIHLGSWRGQGGYEGLCVSLLDYIEDMGFTHIELMP
VHEHPFAGSWGYQPVGLYAPAARYGKPDQLRTFVNAAHSRGIGVILDWVPAHFPEDPHGL
AMFDGTALYEHQDSREGRHPDWGTLIYNFGRREVKDFLTSNALYWLEEFHIDALRVDAVA
SMIYRDYSRPAGEWIPNIYGGNQNLEAIAFLQDLNTAVYREAPGIMMIAEESTSYPGVTR
PVDQQGLGFGYKWNMGWMNDILRYMSRESIHKKYHHHEATFSTVYAGSEHYILPFSHDEV
VHGKKSLLAKMPGDANQQFANLRALYAFMWGHPGKKLLFMGQEFAQSREWNHDENLNWWE
ADQPQGRAMSSFLRDLNRLYRRYPALHGSDRDGFTWVDANADQDSIFVWLRHVPNDPAPV
LIAINMTPVDREVQIGLPRAGNWREILNSDAAVYGGGNLGNLGGISALDMPMQGQPYGAT
LTVPGLSAIWLTPDEQN
NT seq 2034 nt NT seq  +upstreamnt  +downstreamnt
atgcccgatgcggcggcggtattcctatgctgcgatgatggaaaaacgcctatgcagcag
catcctgacgcggcgggtctatggactgcgacaatgccggttgcgccaagctatcgtttt
gaggcgcattttttggatggtgcagtctatggatggcaagacgcttaccgatacggctca
ctttttcacgacaaatggtctcaatcgcctaatggtttgcgtttatggcattctttaggc
gcacattgcgtagaggtatcgggcgtcaagggcacatttttcgcggtgtgggcaccaaac
gcaaggcgcgtcagcgtcgtgggggatttcaatcactgggacggccgccgcgctccgatg
cggctgcagcatggctgcggtatatgggagatattcctgcccgatgtcactgcagatgcc
ctgtataaattcgaggtgttgggtgcggatggtataatgagactgaaggcggacccctat
ggccaacaggccgagcgcgcgccgggcaatgcctccatcgtgacaatgaaatccgcgttt
gcctggacggataaggattggatgacgacacgcggcagccgccactcccctgatgcgccc
atatccatctatgaaattcatcttggatcatggcgggggcagggcggttatgagggactt
tgcgtcagtcttttggattacattgaagacatgggctttacgcatatcgagctgatgcct
gtccatgagcatcctttcgcagggtcgtggggatatcagcccgtcggcctttatgcgccg
gcggcacgatatggcaaacctgaccagctacgcacattcgtaaacgctgcgcatagccgc
ggtataggtgtgatcctcgactgggttcccgcccactttcccgaagatccacatggattg
gccatgtttgatggaacagccctctatgaacatcaggactcacgcgaagggcgccacccc
gattgggggacgctgatctataattttggccgccgcgaagtcaaagattttctaacttca
aatgcactctattggctggaggagtttcacatcgatgctcttcgggtcgatgccgtggcc
tcgatgatctatcgtgattactcacgcccagcaggtgaatggataccaaatatatatggc
ggcaatcaaaacctggaagcgatcgcgtttttgcaggatttgaacacggcagtttatcgc
gaagctcctggaattatgatgattgcagaggaatcgacaagttatcccggtgtcacacgg
ccagtcgatcagcagggcttgggatttggttataagtggaacatgggctggatgaatgac
attctgcgttacatgtcacgcgagtcgatccataagaaataccatcaccatgaagctaca
ttcagcaccgtttatgccggctcggagcattacatcctgcctttcagccatgacgaggtt
gtgcatggcaaaaagtcgcttttggcgaagatgccgggcgacgcgaaccagcaatttgca
aatcttcgggccctttacgcctttatgtggggacatcccggcaagaagttattgttcatg
gggcaggaattcgcgcaaagccgcgaatggaaccatgacgaaaacctgaattggtgggag
gcagaccagccgcagggacgtgctatgtcgtcttttttgcgcgatctgaacaggttatac
cgcagatatccggcccttcatggtagtgaccgcgacggatttacgtgggtagatgcgaat
gcagaccaggactctatctttgtctggttacgccacgtgcctaacgatcccgctcccgtg
ctgattgcgatcaatatgacgcctgtggatcgcgaggtgcagatcggtctgccacgcgca
ggaaattggcgcgaaatcctcaattctgacgcggcggtctatggtgggggtaatcttgga
aatcttggcgggatttcagccctggatatgcctatgcaggggcagccctatggcgcgacg
ctgactgtgccggggctttcggcgatatggctgacgcccgatgagcaaaactag

DBGET integrated database retrieval system