KEGG   Ketogulonicigenium vulgare WSH-001: KVU_2133Help
Entry
KVU_2133          CDS       T01909                                 

Gene name
dapE
Definition
succinyl-diaminopimelate desuccinylase 1 (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
kvl  Ketogulonicigenium vulgare WSH-001
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:kvl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    KVU_2133 (dapE)
  Amino acid metabolism
   00300 Lysine biosynthesis
    KVU_2133 (dapE)
Enzymes [BR:kvl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     KVU_2133 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2247917..2249059)
Genome map
AA seq 380 aa AA seqDB search
MSFDAVKLTADLIKCPSVTPHEGGALVLLERALTDAGFACTRVDRGGISNLFARWGRKGA
NRSFGFNGHIDVVPVGDASQWTFDPFGAEIVDGYMYGRGAVDMKSGVAAFVGAAIDFTRN
TPPDGAIVLTITGDEEDVGEDGTRALLDWMAENGEAMSVCIVGEPTSPEVLGDMMKIGRR
GSATVWFTVTGQQGHAAYPQRALNPMPAMARLMDRLSSRVLDEGTDHFDSSSLQVVTIDT
GNGATNVIPGQTRATINVRFNDIHTGASLVDWMQAEADKVAAEFGVQVALRSRISGEAFL
TPPGALSDLVAAAVKAETGLSPVLSTSGGTSDARFVKSHCPVVEFGLVGKRMHGVDERVE
IVQIGQLQAIYTRVLADYFA
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgagtttcgatgccgtcaaactgaccgccgatctgatcaaatgtccctcggtcaccccg
catgaggggggggcgttggttctgctggaacgcgcgctgacagatgccggtttcgcatgc
acccgcgtcgatcgcggcggcatcagcaacctgtttgcccgctggggccgcaagggcgcg
aaccgcagcttcggctttaacggccatatcgacgtggtgccggtgggcgatgccagccag
tggacgtttgatccgttcggggcggaaattgtcgacggctatatgtatgggcgcggcgcg
gtggatatgaaatcgggcgtcgcggcctttgtcggcgcggcgattgatttcacgcgcaat
accccgcctgatggcgcgattgtgctgaccattaccggcgacgaggaagacgtcggcgag
gatggcacccgcgccttgctggattggatggccgagaatggcgaggcgatgtccgtctgc
atcgtgggcgagccgaccagccccgaagttttgggcgatatgatgaaaatcggccgtcgc
ggctcggccacggtatggttcacggtgacgggtcaacagggccatgcggcctatccgcag
cgcgcgctgaacccgatgcccgcgatggcgcggctgatggataggttgtcgtcgcgcgtg
ctggacgagggcaccgatcacttcgactcgtcctcgctgcaggttgtgacgattgatacc
ggcaacggcgcaacgaatgtgatcccgggccagacgcgcgccacgatcaatgtgcggttc
aacgacatccacaccggcgcgagccttgtcgattggatgcaggccgaggcggataaagtc
gccgccgaattcggtgtgcaagtggctctgcgcagccgcatctcgggcgaagcgttcctg
accccgcccggcgcgctgtcggatctggtggcggcggcggtcaaggcggaaaccggactg
tcaccggtgctgtcgaccagcggcggcacatcggatgcgcgtttcgtgaaatcgcattgc
cccgtcgtggaattcggccttgtcggcaagcggatgcacggcgtcgatgaacgggtcgag
atcgttcagatcggccagctgcaagcaatttatacccgcgtgctggccgattatttcgcc
tga

DBGET integrated database retrieval system