KEGG   Ketogulonicigenium vulgare WSH-001: KVU_2181Help
Entry
KVU_2181          CDS       T01909                                 

Definition
(RefSeq) uroporphyrinogen III synthase HEM4
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
kvl  Ketogulonicigenium vulgare WSH-001
Pathway
kvl00860  Porphyrin and chlorophyll metabolism
kvl01100  Metabolic pathways
kvl01110  Biosynthesis of secondary metabolites
kvl01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:kvl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    KVU_2181
Enzymes [BR:kvl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     KVU_2181
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-GeneID: 12375105
NCBI-ProteinID: YP_005796016
UniProt: F9Y5U5
Position
complement(2302865..2303548)
Genome map
AA seq 227 aa AA seqDB search
MAATLLLTRPLGAAQRFLDGLGVETPHLISPIMRIVPLTPQVLRVPKALVLTSENGAAAL
ARLDLPPGLPAWCVGLRTAEVARANGADAIVAGPDAAHLLPRILAEGGNGPFLHLRGAHV
AADVAVALQSAGRVCDALVVYDQQDCPLSPAALALLNGTAPVVLPLFSPRSAALVAKAGP
FAAPLIIVAISPAAAALAPSAAKVYVAPTPELSAMQRLVAQAVGEAG
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atggccgcgacattgctgctgacccgcccgctcggcgcggcccagcgatttttggatggg
ctgggggtcgagacgccccatctgatcagcccgatcatgcggatcgtcccgctgaccccg
caggtgttgcgcgtgccaaaggcgctggtgctgacatcggaaaatggcgcggcggccttg
gcgcgccttgatctgccgcccggcctgcccgcgtggtgtgtcggcctgcgcacagccgag
gttgcccgcgccaatggcgccgatgccatcgtggcaggccccgatgccgcgcatttgctg
ccccgcattctggccgagggcggaaatggcccttttttgcatttgcgcggcgcgcatgtt
gccgcagatgtggccgtggcgctacagtcggcggggcgtgtttgcgatgctttggtggtc
tatgatcagcaggattgcccgctttcacccgccgcccttgcgctattgaatggcacagcg
cctgtggttctgccgctgttttcaccgcgatctgcggctttggtggcgaaagcggggcca
tttgcggccccattgatcatcgtggccatcagcccggctgcggcagcattggcaccatcc
gccgcaaaggtttacgttgcgcccacgcctgaactttcggcaatgcagcgccttgtcgcg
caagccgttggcgaagcgggttga

DBGET integrated database retrieval system