KEGG   Ketogulonicigenium vulgare WSH-001: KVU_2198Help
Entry
KVU_2198          CDS       T01909                                 

Gene name
gtaB
Definition
nucleotidyl transferase superfamily protein (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
kvl  Ketogulonicigenium vulgare WSH-001
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:kvl00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    KVU_2198 (gtaB)
   00052 Galactose metabolism
    KVU_2198 (gtaB)
   00500 Starch and sucrose metabolism
    KVU_2198 (gtaB)
   00520 Amino sugar and nucleotide sugar metabolism
    KVU_2198 (gtaB)
Enzymes [BR:kvl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     KVU_2198 (gtaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2318888..2319787)
Genome map
AA seq 299 aa AA seqDB search
MRKVRKAVFPVAGLGTRFLPATKAVPKEVLTLVDRPLIQYAIDEAREAGITDFIFVTARG
KSALENYFDQNPELERALLDAGKTKLLEALAPSNMDSGAIAYVRQHKALGLGHAVACASK
LIGDEPFAVILPDDVIAAQPSCLKQMVEAYEEIGNEGCLVATMEVPDSMISSYGVLDVKA
GEGRLVEAKGMVEKPKLGTEPSNLAVIGRYILSPRVLQNLTEIKPGAGGEIQLTDAIAAE
FAKGGKVCGYRFDGQRFDCGSKAGFLQATVHFGLNHPELREELADYLRHIVNDELGATV
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgaggaaagttcgcaaagctgtattccccgtcgcaggtctgggtacccgttttctgccc
gctaccaaggccgtgccaaaggaagttctgacgctggttgaccgccccttgatccaatat
gcgatcgacgaggcccgcgaggccggtattaccgatttcatcttcgtcactgcgcgcggt
aaatctgcgctggaaaactacttcgaccagaaccctgaacttgagcgcgccctgctggac
gccggtaaaaccaagctgcttgaggcgctggcccccagcaatatggacagcggcgccatt
gcctatgtgcgccagcacaaggcgctaggtctgggtcatgcggttgcctgtgcgtccaag
ctgatcggggacgagccctttgccgttatcctgcctgatgatgtgatcgcggcgcagccc
tcgtgcctcaagcagatggtcgaagcctatgaagagatcggcaatgaaggctgcctcgtt
gcgacgatggaagtgcccgattcgatgatctcttcctatggcgtgttggatgtgaaagct
ggcgagggccgtctggtcgaggccaagggcatggttgaaaagccaaagctgggcaccgag
ccgtcgaaccttgcggtgatcggccgttatatcctgtcgccgcgtgttttgcagaacctg
accgagatcaaacccggcgcaggtggcgagattcaattgaccgacgccattgccgccgaa
ttcgccaaaggtggcaaggtctgcggttaccgtttcgatggtcagcgctttgactgcgga
tcgaaagcgggtttcttgcaggcgacggtgcatttcggcctgaaccatcccgagctgcgc
gaagagctggctgattacctgcgccacatcgtgaacgacgaacttggtgcaacggtctga

DBGET integrated database retrieval system