KEGG   Ketogulonicigenium vulgare WSH-001: KVU_2238Help
Entry
KVU_2238          CDS       T01909                                 

Gene name
rbsK
Definition
Kinase, pfkB family protein (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
kvl  Ketogulonicigenium vulgare WSH-001
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:kvl00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    KVU_2238 (rbsK)
Enzymes [BR:kvl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     KVU_2238 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2360378..2361244)
Genome map
AA seq 288 aa AA seqDB search
MTIWNLGSINVDNTYALHHIVAPGETIVASNLLTGLGGKGANMSVAMSRAGGKVVHIGAV
GRDLDWPVARLAEYGVDTGFIATVDEATGHAIITVDRSGENAIIVYSGANNAVPLEVLKA
ALAEAKIGDRFVMQNETNNQAEAARLARAAGLWVAYAAAPFSAAAVEAVLPHIDFLILNE
VEAAQLQEATGKAPQDLGVRDVIVTLGGDGAAWYGEDGVQKFPAIKVTPVDTTGAGDTVT
GYIIAGLDNGLLMPEAINQAMKAGALMVMRHGTADVIPKLPEVQTFSV
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgacaatctggaatttggggtcgatcaacgtcgacaacacctatgcgctgcatcatatc
gtagcgcccggcgagacgatcgtggccagcaacctgctgaccggactgggcggcaagggc
gcgaatatgtcggttgcgatgtcgcgcgcgggcggcaaggttgtccatatcggcgcggtt
ggtcgcgatctggattggccggtggcacgccttgccgaatatggcgtcgatacgggtttt
atcgccacggtggacgaggcgacgggccatgcgatcatcacggtcgaccgctcgggcgaa
aacgcgatcatcgtctattcgggtgcgaataatgccgtcccccttgaggtgctaaaggcc
gcgctggccgaggcgaagatcggtgaccgttttgtcatgcagaacgagaccaataatcag
gccgaggccgcacgtctggcccgcgcggccggtctgtgggttgcctatgccgctgcgccc
tttagcgcggctgcagtcgaggctgtcctgccccatatcgactttctcatcctgaacgag
gtcgaggccgcgcagctacaagaggccaccggcaaagcgccgcaagatctgggcgtgcgc
gatgtgatcgtcactttgggcggcgatggtgccgcctggtatggcgaggatggcgtgcaa
aagtttcccgccatcaaagtcacccccgtggataccaccggcgcgggcgatacggtcacc
ggctatattatcgcgggcctcgacaatggtttgctgatgcccgaggcgatcaatcaggcg
atgaaagcgggcgcgttaatggtcatgcgccatggcacagccgatgtgatcccgaaactg
ccggaagttcagactttttcggtttga

DBGET integrated database retrieval system