KEGG   Ketogulonigenium vulgarum: KVU_2338Help
Entry
KVU_2338          CDS       T01909                                 

Gene name
pncA
Definition
isochorismatase hydrolase (EC:3.5.1.19)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
kvl  Ketogulonigenium vulgarum
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:kvl00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2473729..2474349
Genome map
AA seq 206 aa AA seqDB search
MQTRDPFPENEALIVIDVQNDFCPGGALAVAGGDQIVAGINDLMAQFQTVVLTQDWHPAG
HSSFASSHAGQSPYSVIDMPYGPQVLWPDHCVQGTGGADFHPALNVHAAHLVIRKGFRPG
IDSYSAFFENDHSTVTGLDGYLRARGITRVTLVGLATDFCVNYSAVDAARLGYAVSVDTG
LSRGIDLNGSLADALETMAEAGVVIK
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgcaaacgcgcgatccctttccggaaaatgaggctctgatcgtcatcgacgtgcagaat
gatttctgtccaggcggtgccttggccgtggcgggcggggatcagatcgtcgccggcatc
aatgatctgatggcgcagttccagaccgtggtgctgacgcaggattggcaccccgcaggt
cattccagctttgccagcagccatgcaggccagagcccctatagcgtgatcgacatgccc
tatggcccgcaggtgctgtggcccgatcactgcgtccaaggcacaggcggcgcggatttc
caccccgcgctgaatgtgcatgcggcgcatctggtgatccgcaaaggcttccgccccggc
atcgacagctattcggctttctttgaaaacgaccacagcacggtgacaggccttgatggc
tacttgcgcgcgcgcggcatcacgcgcgtgacgctggtcggcctcgccacggatttttgc
gtgaattattctgcggtggatgcggcgcgccttggctatgcggtgagtgtcgacaccggc
ctctcgcgcgggatcgacctgaacggctcgctggccgatgcgctggaaaccatggccgag
gctggcgtcgttatcaagtaa

DBGET integrated database retrieval system