KEGG   Ketogulonigenium vulgarum: KVU_2387Help
Entry
KVU_2387          CDS       T01909                                 

Definition
alkaline phosphatase (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
kvl  Ketogulonigenium vulgarum
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:kvl00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:kvl00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:kvl02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2527799..2529232
Genome map
AA seq 477 aa AA seqDB search
MKTIKALPLALLASTAFVAPALAQEQAKNIILLITDGAGPESWSAGTYYRFGALGHEVYD
GFDLKAYMATHPLNTSSEPTFSDEGTVTFDPAELWTDTAVDTVYEGALGNYAGYFSGYDY
ARADYTDSAAAATAIASGQKSYNNSINWSNNGESLRHIGEYVVDSGRALGVVSSVQMSHA
TPAGFLAHNVSRNDYAAIGAEIVESGLATVVMGAGHPLFDAAGQAVATPSDNAYRYVGGR
DVWDRLVAGETAYQLIETKDDFEALANGDLALTGDKVFGLVQNSATLQFNRPGVGLGDWL
ENSPDLPTMTRAALNVLAADEDGFFLMVEGGAVDWAAHANNLPRLIEEQIDFNMAVEAAA
EWVEANSSWEETMIIVTTDHGNGLLQGPLSDTVAYQPIVNQGQGAMPLVRWHSDTHTREL
VPVFAHGAGSEYFRSIAAEETGLSRYTTDAASQIWFDNTDIFRGALTAMGIDEVAAQ
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgatcaaagcccttccgctcgccctgctggctagcactgcctttgtggcgccc
gcccttgcgcaagagcaagccaagaacatcatcctgctgatcaccgacggcgccggccct
gaaagctggagcgccggcacctattatcgttttggtgcactgggtcacgaagtctatgac
ggctttgacctgaaagcctatatggcgacgcatccgctgaacacctcgtccgagccgacc
ttttcggacgaaggcaccgtgacgttcgacccggctgaactgtggaccgacaccgccgtc
gacaccgtttatgaaggcgcgctgggcaactacgctggctacttctcgggctatgactat
gcccgcgctgattataccgactcggctgctgctgcgaccgctatcgcttcgggccaaaag
tcgtacaacaactcgatcaactggtcgaacaacggcgaatcgctgcgtcacatcggcgaa
tatgtcgtcgactcgggccgcgcgctgggcgtcgtctcgtcggttcaaatgagccacgcc
acccccgcaggtttcctggcccataacgtgtcgcgtaacgactatgcggcgatcggtgct
gaaatcgttgaatcgggtctggccactgtcgtcatgggcgccggtcacccgctgttcgac
gccgccggccaagctgtcgctaccccgtcggacaacgcctaccgctatgtcggtggccgc
gatgtctgggaccgtctggttgctggcgagaccgcctaccaactgatcgagaccaaagac
gacttcgaagcgctggcaaacggcgatctggccctgaccggcgataaagtgttcggtctg
gtgcagaactcggccacgctgcagttcaaccgtccgggcgttggccttggcgactggctg
gaaaactcgcccgacctgccgaccatgacccgcgccgcgctgaacgtgctggccgctgac
gaagacggcttcttcttgatggtcgaaggcggcgctgttgactgggcggcccacgccaac
aacctgccgcgtctgatcgaagagcaaatcgatttcaacatggctgtcgaagctgcggct
gaatgggtcgaggcgaattcgtcgtgggaagaaacgatgatcatcgtcaccaccgaccac
ggcaacggcctgctgcaaggcccgctgtcggacaccgtcgcctaccagccgatcgtgaac
caaggccaaggcgcaatgccgctggtgcgctggcactcggacacccacacccgcgagctg
gtgccggtcttcgcccatggtgcaggttcggaatacttccgcagtatcgcggccgaggaa
actggtctgtcgcgctataccactgatgcggcttcgcaaatctggttcgacaacaccgat
atcttccgcggcgcactgaccgccatgggtatcgacgaagtcgcggcccagtaa

DBGET integrated database retrieval system