KEGG   Ketogulonicigenium vulgare WSH-001: KVU_2454Help
Entry
KVU_2454          CDS       T01909                                 

Gene name
sucB
Definition
(RefSeq) dihydrolipoyllysine-residue succinyltransferase, E2 component of oxoglutarate dehydrogenase (EC:2.3.1.61)
  KO
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
kvl  Ketogulonicigenium vulgare WSH-001
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:kvl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    KVU_2454 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    KVU_2454 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    KVU_2454 (sucB)
Enzymes [BR:kvl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     KVU_2454 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2595275..2596492)
Genome map
AA seq 405 aa AA seqDB search
MSTEVRVPTLGESVTEATVATWFKKPGDAVAVDEMLCELETDKVTVEVPSPAAGTLAEII
AAEGETVGVGALLAQITAGAAAPAPAPAAAPIAPPKAEVKPVPEATARKGDDAPSARKLM
AENNIEASAVAGSGRDGRVMKGDVLAALVSAPAAPAPAAAPAAPRAASRADDAPREERVK
MTRLRQTIARRLKEAQNTAAMLTTYNEVDMTAIMDLRNQYKDLFEKKHGVKLGFMSFFAK
ACAHALAEVPEVNAEIDGDSVIYKRYVHMGVAVGTPNGLVVPVVRDTDTKSFAQIEKEIA
GFGRKARDGKLSIEDMQGGTFTISNGGVYGSLMSSPILNPPQSGILGMHKIQDRPIALNG
QVVIRPMMYLALSYDHRIVDGQGAVTFLVRVKEALEDPRRLLMDL
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccgaagtccgtgttccgacgctgggagaaagcgtcaccgaagccaccgtggca
acatggttcaaaaagcccggcgatgccgtcgcggtcgacgaaatgctgtgcgagctggaa
accgacaaagtaacggtcgaggttccctcgcccgctgccggcaccttggccgagattatc
gcggctgagggggagaccgtcggtgtcggcgccctgctggcgcagatcactgcgggtgcc
gccgcgcctgcgcctgcgcccgccgctgcccccatcgcgccgcccaaggccgaggtgaag
cccgtccccgaggccaccgcccgcaagggcgatgacgccccctcggcgcgcaagctgatg
gcggaaaacaatattgaggccagcgccgtcgcaggctcgggccgcgatggccgcgtgatg
aaaggcgatgtcctggccgcattggtcagcgcacctgccgcgcccgcacctgccgcggcc
cccgccgcgccgcgcgccgccagccgcgccgatgatgcgccgcgcgaggaacgcgtaaag
atgacccgcctgcgccagaccatcgcgcgccggttgaaagaggcgcaaaacaccgccgcc
atgctgaccacctataacgaggtggacatgacggcgatcatggatttgcgcaatcaatac
aaagacctgtttgaaaagaaacacggcgtgaagctgggctttatgtcctttttcgccaag
gcctgcgcccatgctttggccgaagtgcccgaggtgaatgccgagatcgacggcgattcg
gtgatctacaaacgctatgtccatatgggcgtggcggttggcacgccgaatggtctggtg
gttcccgtcgtgcgcgacaccgataccaaatcctttgcgcagatcgagaaagagatcgca
ggctttggccgcaaggcgcgcgatggcaaactctcgatcgaggatatgcagggcggcacc
tttaccatctcgaatggtggtgtgtatggctcgctgatgtcctcgcccattttgaacccg
ccgcaatcgggcattctgggcatgcacaagatccaggatcgccccatcgccctgaatggc
caagttgtgatccggccgatgatgtatctggctttgtcctatgatcaccgtattgtggat
ggtcagggggcggtgactttccttgtgcgcgtgaaagaagcgctggaagatccgcgccgc
ctgttaatggatctgtaa

DBGET integrated database retrieval system