KEGG   Ketogulonicigenium vulgare WSH-001: KVU_2454Help
Entry
KVU_2454          CDS       T01909                                 

Gene name
sucB
Definition
(RefSeq) dihydrolipoyllysine-residue succinyltransferase, E2 component of oxoglutarate dehydrogenase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
kvl  Ketogulonicigenium vulgare WSH-001
Pathway
kvl00020  Citrate cycle (TCA cycle)
kvl00310  Lysine degradation
kvl01100  Metabolic pathways
kvl01110  Biosynthesis of secondary metabolites
kvl01120  Microbial metabolism in diverse environments
kvl01130  Biosynthesis of antibiotics
kvl01200  Carbon metabolism
Module
kvl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
kvl_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:kvl00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    KVU_2454 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    KVU_2454 (sucB)
Enzymes [BR:kvl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     KVU_2454 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H
Motif
Other DBs
NCBI-GeneID: 12375394
NCBI-ProteinID: YP_005796289
UniProt: F9Y7J7
Position
complement(2595275..2596492)
Genome map
AA seq 405 aa AA seqDB search
MSTEVRVPTLGESVTEATVATWFKKPGDAVAVDEMLCELETDKVTVEVPSPAAGTLAEII
AAEGETVGVGALLAQITAGAAAPAPAPAAAPIAPPKAEVKPVPEATARKGDDAPSARKLM
AENNIEASAVAGSGRDGRVMKGDVLAALVSAPAAPAPAAAPAAPRAASRADDAPREERVK
MTRLRQTIARRLKEAQNTAAMLTTYNEVDMTAIMDLRNQYKDLFEKKHGVKLGFMSFFAK
ACAHALAEVPEVNAEIDGDSVIYKRYVHMGVAVGTPNGLVVPVVRDTDTKSFAQIEKEIA
GFGRKARDGKLSIEDMQGGTFTISNGGVYGSLMSSPILNPPQSGILGMHKIQDRPIALNG
QVVIRPMMYLALSYDHRIVDGQGAVTFLVRVKEALEDPRRLLMDL
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccgaagtccgtgttccgacgctgggagaaagcgtcaccgaagccaccgtggca
acatggttcaaaaagcccggcgatgccgtcgcggtcgacgaaatgctgtgcgagctggaa
accgacaaagtaacggtcgaggttccctcgcccgctgccggcaccttggccgagattatc
gcggctgagggggagaccgtcggtgtcggcgccctgctggcgcagatcactgcgggtgcc
gccgcgcctgcgcctgcgcccgccgctgcccccatcgcgccgcccaaggccgaggtgaag
cccgtccccgaggccaccgcccgcaagggcgatgacgccccctcggcgcgcaagctgatg
gcggaaaacaatattgaggccagcgccgtcgcaggctcgggccgcgatggccgcgtgatg
aaaggcgatgtcctggccgcattggtcagcgcacctgccgcgcccgcacctgccgcggcc
cccgccgcgccgcgcgccgccagccgcgccgatgatgcgccgcgcgaggaacgcgtaaag
atgacccgcctgcgccagaccatcgcgcgccggttgaaagaggcgcaaaacaccgccgcc
atgctgaccacctataacgaggtggacatgacggcgatcatggatttgcgcaatcaatac
aaagacctgtttgaaaagaaacacggcgtgaagctgggctttatgtcctttttcgccaag
gcctgcgcccatgctttggccgaagtgcccgaggtgaatgccgagatcgacggcgattcg
gtgatctacaaacgctatgtccatatgggcgtggcggttggcacgccgaatggtctggtg
gttcccgtcgtgcgcgacaccgataccaaatcctttgcgcagatcgagaaagagatcgca
ggctttggccgcaaggcgcgcgatggcaaactctcgatcgaggatatgcagggcggcacc
tttaccatctcgaatggtggtgtgtatggctcgctgatgtcctcgcccattttgaacccg
ccgcaatcgggcattctgggcatgcacaagatccaggatcgccccatcgccctgaatggc
caagttgtgatccggccgatgatgtatctggctttgtcctatgatcaccgtattgtggat
ggtcagggggcggtgactttccttgtgcgcgtgaaagaagcgctggaagatccgcgccgc
ctgttaatggatctgtaa

DBGET integrated database retrieval system