KEGG   Ketogulonicigenium vulgare WSH-001: KVU_2457Help
Entry
KVU_2457          CDS       T01909                                 

Gene name
sucC
Definition
ATP-dependent carboxylate-amine ligase-like protein (EC:6.2.1.5)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
kvl  Ketogulonicigenium vulgare WSH-001
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:kvl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    KVU_2457 (sucC)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    KVU_2457 (sucC)
   00640 Propanoate metabolism
    KVU_2457 (sucC)
   00660 C5-Branched dibasic acid metabolism
    KVU_2457 (sucC)
Enzymes [BR:kvl01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     KVU_2457 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2600386..2601603)
Genome map
AA seq 405 aa AA seqDB search
MNIHEYQAKGLLRDYQIPVGAGQIILNSRDADQAAAALQGPLWVVKAQIHAGGRGKGHFI
EEAAGAGGGVRLARSASEAAQIARQMLDNTLVTVQTGPKGRKVGRVYLEAGADIARELYL
ALLIDRKTSRISFVCSTEGGVDIEHVAATTPEKVITIAVDPATGFQQWHGRAIAFALELS
GAQIKECVALTGNLYRAFTERDMEMLEINPLIVTPAGHLHCLDAKVGFDNNALYRHPEIA
ALRDEAEEDEKELAASKFDLNYITLDGSIGCMVNGAGLAMATMDIIKLYGSAPANFLDVG
GGASKEKVTEAFKIITSDPNVQGILVNIFGGIMRCDIIADGIIAAVREVGLQVPLVVRLE
GTNVEIGKDIIRNSGLNVIPADDLADAAQKIVAAVKDATHKAAEA
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgaatattcatgaatatcaggcaaaaggccttttgcgtgattaccagatccccgttgga
gcgggtcagatcatcctgaacagccgtgatgccgaccaagctgcggccgcgctgcagggc
ccgctatgggtggtaaaggcgcaaatccacgcaggtggtcgcggcaaaggccatttcatc
gaggaggccgcaggtgccggcggcggtgtccgcctcgcgcgctcggcgtccgaggccgcg
cagatcgcgcgccagatgctggacaacacccttgtcaccgtgcagaccggccccaagggt
cgcaaagtcggccgcgtctatcttgaagctggcgccgatatcgcgcgcgagctgtatctg
gcgctgctgatcgatcgcaaaacctcgcgcatctcgttcgtttgttcgaccgagggcggc
gtcgatatcgaacatgtcgctgcaacgacgccggaaaaggtcatcaccattgcggtcgat
cccgcgacgggtttccagcaatggcatggccgcgccattgcctttgcgctggaactgtcc
ggcgcgcagatcaaggaatgcgtcgccctgaccggcaatctttaccgcgccttcaccgag
cgcgacatggagatgctcgagatcaatcccctgatcgtgacgccagcgggccatctgcac
tgcctcgacgccaaggtcggttttgacaacaacgccctttatcgtcaccccgaaatcgcc
gccctgcgcgacgaggccgaggaggacgaaaaggagcttgctgcgtccaaattcgatctg
aactatatcacgctggacggcagcatcggctgcatggtcaacggcgcgggccttgcgatg
gcgacgatggatatcatcaagctctatggttcggcgcccgcgaactttctggatgtcggc
ggcggcgccagcaaagaaaaggtgaccgaggcgttcaagatcatcacctctgaccccaat
gtgcaggggattttggtgaacatctttggcggcatcatgcgctgcgatatcatcgccgac
ggtatcattgccgccgtgcgcgaggttggcctgcaagtgccccttgtcgtccggttggag
ggcacgaatgtcgaaatcggcaaggatatcatccgcaattccggcctgaacgtgataccc
gcagacgatctggcggatgcggcgcaaaagatcgtcgcggcggtcaaggatgcaacccat
aaggcagcggaggcttga

DBGET integrated database retrieval system