KEGG   Ketogulonigenium vulgarum: KVU_2461Help
Entry
KVU_2461          CDS       T01909                                 

Gene name
sdhD
Definition
succinate dehydrogenase, hydrophobic membrane anchor protein (EC:1.3.99.1)
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
kvl  Ketogulonigenium vulgarum
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:kvl01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:kvl00020]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:kvl00650]
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:kvl00190]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2603865..2604248
Genome map
AA seq 127 aa AA seqDB search
MRYLTDRKRAVGNGASRTGTFDHIFMTSTSYGLLVLVPCLVWVLGNALFLPFDQARAYVG
RPFPLIVLGLTLVVGLRHFAVGAQMMLEDYLQGFAREITVLIARGLSWLLIATGLLALVR
LALGQPS
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atgcgttatttgacggatcgcaaacgtgccgttggcaatggcgcatcgcgcacgggcacg
tttgaccatattttcatgacctcgacatcttatggcttgctggtgctggtgccttgcctg
gtctgggtgctggggaatgcgctgttcctgccgtttgatcaggcgcgcgcctatgtcggt
cggccgtttccgctgatcgtcttgggtttgacgctggtggtcggtctgcgccactttgct
gtcggcgcacagatgatgctggaagattacctgcagggctttgcccgtgaaattaccgtg
ctgatcgcccgcggcctgtcgtggctgctgatcgcgaccggcctgttggcgctggtgcgt
ctggcgctgggccaaccttcatga

DBGET integrated database retrieval system