KEGG   Ketogulonicigenium vulgare WSH-001: KVU_2461Help
Entry
KVU_2461          CDS       T01909                                 

Gene name
sdhD
Definition
succinate dehydrogenase, hydrophobic membrane anchor protein (EC:1.3.99.1)
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
kvl  Ketogulonicigenium vulgare WSH-001
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:kvl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    KVU_2461 (sdhD)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    KVU_2461 (sdhD)
   00650 Butanoate metabolism
    KVU_2461 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    KVU_2461 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2603865..2604248
Genome map
AA seq 127 aa AA seqDB search
MRYLTDRKRAVGNGASRTGTFDHIFMTSTSYGLLVLVPCLVWVLGNALFLPFDQARAYVG
RPFPLIVLGLTLVVGLRHFAVGAQMMLEDYLQGFAREITVLIARGLSWLLIATGLLALVR
LALGQPS
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atgcgttatttgacggatcgcaaacgtgccgttggcaatggcgcatcgcgcacgggcacg
tttgaccatattttcatgacctcgacatcttatggcttgctggtgctggtgccttgcctg
gtctgggtgctggggaatgcgctgttcctgccgtttgatcaggcgcgcgcctatgtcggt
cggccgtttccgctgatcgtcttgggtttgacgctggtggtcggtctgcgccactttgct
gtcggcgcacagatgatgctggaagattacctgcagggctttgcccgtgaaattaccgtg
ctgatcgcccgcggcctgtcgtggctgctgatcgcgaccggcctgttggcgctggtgcgt
ctggcgctgggccaaccttcatga

DBGET integrated database retrieval system