KEGG   Ketogulonicigenium vulgare WSH-001: KVU_2461Help
Entry
KVU_2461          CDS       T01909                                 

Gene name
sdhD
Definition
succinate dehydrogenase, hydrophobic membrane anchor protein (EC:1.3.99.1)
Orthology
K00242  
succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
kvl  Ketogulonicigenium vulgare WSH-001
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:kvl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    KVU_2461 (sdhD)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    KVU_2461 (sdhD)
   00650 Butanoate metabolism
    KVU_2461 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    KVU_2461 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2603865..2604248
Genome map
AA seq 127 aa AA seqDB search
MRYLTDRKRAVGNGASRTGTFDHIFMTSTSYGLLVLVPCLVWVLGNALFLPFDQARAYVG
RPFPLIVLGLTLVVGLRHFAVGAQMMLEDYLQGFAREITVLIARGLSWLLIATGLLALVR
LALGQPS
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atgcgttatttgacggatcgcaaacgtgccgttggcaatggcgcatcgcgcacgggcacg
tttgaccatattttcatgacctcgacatcttatggcttgctggtgctggtgccttgcctg
gtctgggtgctggggaatgcgctgttcctgccgtttgatcaggcgcgcgcctatgtcggt
cggccgtttccgctgatcgtcttgggtttgacgctggtggtcggtctgcgccactttgct
gtcggcgcacagatgatgctggaagattacctgcagggctttgcccgtgaaattaccgtg
ctgatcgcccgcggcctgtcgtggctgctgatcgcgaccggcctgttggcgctggtgcgt
ctggcgctgggccaaccttcatga

DBGET integrated database retrieval system