KEGG   Ketogulonicigenium vulgare WSH-001: KVU_2472Help
Entry
KVU_2472          CDS       T01909                                 

Definition
beta-N-acetylhexosaminidase protein (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
kvl  Ketogulonicigenium vulgare WSH-001
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:kvl00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    KVU_2472
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    KVU_2472
Enzymes [BR:kvl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     KVU_2472
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2621435..2622457
Genome map
AA seq 340 aa AA seqDB search
MTSTPLALSIGMPGLALDADEIAFLREANPYALFLFKRNLDNPDQIRRLCAQFRDAVGRP
DAPVFVDQEGGRVTRLDNGNWPLFRPLADFGALARKDMDLAKHALRLSTLAMGSMLSDLS
MNSGAAPVIDLSRSYTHGVMGNRLLDSDPDVVAALGRVIVDAFLEVGQMPMMKHIPGYGH
AAVDPHMELPVVDASLDDLRASDFRPFKALKDTPWAMVAHTLYTQIDAENVATRSAAICN
LIREELEYDGVLISDCITMEALSGTWPERIKGVLDAGYDIALQCQGELGDYQAAAVAARP
LSDATLARIARGDARLGQAHVDARAVHAEVEEIFKTAALA
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgacctcgaccccgcttgccctgtctatcggaatgcccggccttgcgctcgatgcagat
gaaatcgccttcctgcgcgaggcgaacccctatgcgttgttcctgttcaagcggaatctc
gacaatcccgaccagatccgccgcctctgcgcccagttccgcgacgcggtcggccgccct
gatgcgccggtgttcgtcgatcaagagggcggccgcgtcacgcgtctggacaatggcaac
tggccgctgttccgcccgcttgccgattttggcgcattggcgcgcaaggatatggatctg
gcgaaacacgcgctgcgcctgtcgacgctggcgatggggtcgatgctgtcggacttgtcg
atgaacagcggcgcggcgccggtcatcgacctcagccgcagctacacccatggcgtgatg
ggcaaccgcctgctggacagcgaccccgatgttgtcgccgcccttggccgggtgatcgtg
gatgccttcctcgaggtcgggcagatgccgatgatgaaacatattcccggttacggccat
gccgcggtcgatccgcatatggaattgccggtggtcgatgcctcgctggacgatctgcgc
gccagcgatttccgcccgttcaaggcgctgaaagatacgccttgggcgatggtggcgcat
acgctttacacccagatcgacgcggaaaacgtcgcgacgaggtccgccgcaatctgcaac
ttgatccgggaagagctggagtatgacggcgttctgatcagcgattgcatcacgatggag
gcgctgtcgggcacatggcctgagcggatcaaaggtgtgcttgacgcaggttatgacatc
gcgctgcaatgtcagggcgaactcggcgattatcaggccgctgccgtcgccgctcgcccg
ctgtccgatgcgacgctggcccgcattgcacgcggggatgcgcgccttgggcaggcccat
gtcgatgcgcgggccgtccacgccgaagttgaagaaatcttcaagacagccgcgctggcg
taa

DBGET integrated database retrieval system