KEGG   Ketogulonigenium vulgarum: KVU_2511Help
Entry
KVU_2511          CDS       T01909                                 

Gene name
ccpR
Definition
di-heme cytochrome c peroxidase family protein (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
kvl  Ketogulonigenium vulgarum
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2663791..2664957)
Genome map
AA seq 388 aa AA seqDB search
MRKQLCLGFGAALAILAAVATAGANGRYIWPMPAWMPPPPVPAGNPMSAEKVDLGRHLFY
DARLSRDGTVACASCHEQARAFSDGRELAVGIGQTIGIRNAPALANAGYVPQLTWANPHL
TTLEAQALVPLFGEDPVEMGSNGREADIFAALAADPYYTDAFASAFPDRPVIDLFTVTRA
LAAFQRSLISLDSPYDRFKYGGDADAMTPAALRGERLFFDHRFECYHCHGGILFTDSQQT
ARNPAPMLGNHNNGLYNIGGTGAYPARATGLYEFTGLAADMGRFRTPSLRNVAVTAPYFH
DGSAASLREVLDHYAAGGRTISDGPHAGIGAANPFKDGILVGFDASDAEINDLIAFLESL
TDEGFLTNPAYSDPWPADHPARATRMMP
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaagcaactttgccttgggttcggtgcggcgctggcaatccttgccgccgtcgca
accgccggggccaatggacgctatatctggccgatgcccgcgtggatgccgcccccgccc
gtccccgctggcaatccgatgtcagcggaaaaggtcgatctggggcggcacctgttctat
gacgcacggctgtcgcgcgatggcacggtggcctgcgcctcgtgccacgaacaggcgcgc
gcctttagtgacgggcgcgaacttgcggtggggattggccagaccatcggcatccgcaat
gcgcccgcactcgcgaatgcgggctatgtgccgcagctgacatgggccaacccgcatctg
accacgcttgaggcgcaggcgctggtgccgttgtttggcgaagacccggtcgagatgggc
agcaatgggcgcgaggccgatattttcgccgcccttgctgccgatccctattacacggat
gccttcgccagcgcctttcccgatcggcccgtgatcgacctgttcaccgtgacgcgggcc
ttggcagcgtttcagcggtcgctgatctcgcttgatagcccctatgaccggttcaaatat
ggcggtgacgccgatgccatgacgcccgccgccctgcggggcgagcggttgttctttgac
catcggtttgaatgctaccactgccacggcggcatcttgttcaccgacagccagcagacc
gcgcgcaatcccgcgccaatgctggggaaccataataacggtctttataatatcggcggc
acgggggcctaccccgcgcgcgccaccggcctttatgagttcaccggccttgccgctgat
atgggccgtttccgcacccccagcctgcgcaatgtcgcggtgaccgcgccctatttccac
gacggatcggccgcgagtttgcgcgaagtgctggaccattacgccgccggcgggcgcacc
atcagtgatgggccccatgccggtatcggggctgcaaacccctttaaagacggcattctg
gtcggctttgacgcctcggacgccgagatcaacgacctgatcgcctttttggaaagcctg
acagacgagggctttctgaccaaccctgcctattccgatccatggcctgcggatcacccc
gcacgcgcaacaaggatgatgccatga

DBGET integrated database retrieval system