KEGG   Ketogulonicigenium vulgare WSH-001: KVU_2520Help
Entry
KVU_2520          CDS       T01909                                 

Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
kvl  Ketogulonicigenium vulgare WSH-001
Brite
Enzymes [BR:kvl01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     KVU_2520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2673525..2674202
Genome map
AA seq 225 aa AA seqDB search
MQAVIQSSAESDFAALRVTMVDRQVRTSDVTSYPIIAAMLAIPREDFVPDALRDVAYVGA
DLPLAPARTMPEARTLAKMIDGLAIAPDDRALVIGAGLGYGAALVARMAGQVIALEELPH
LAAGAAAALARHKSDARIVQGKLVEGAPEAGPYDVILIEGGVRAIPPVIAAQLAEGGRIV
ALFVEGGLGLVRIGTKVAGQIHWRLAFNALLPVLPGFTTTDTFAL
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgcaggccgttattcaatcatctgccgaatcggattttgcagcactgcgcgtgacgatg
gtggatcgtcaggtgcgcacgtcggatgtgacatcctatccgattatcgccgccatgctg
gccatcccgcgcgaggatttcgtccccgacgccttgcgcgatgttgcctatgtcggcgcg
gatctgccgcttgcgcccgcccgcaccatgcccgaggcccggacgctggcgaaaatgatc
gacgggctggcgattgcgccggatgatcgcgctttggtcattggcgcggggcttggctat
ggcgcggcgctggttgcgcgcatggcggggcaggtcatcgcgctcgaggaattgccgcac
cttgctgcgggcgccgccgccgcgctggcccgtcacaaaagtgacgcgcgcatcgtgcag
ggaaaactggtcgagggggcgccggaagccggaccctatgacgttatattgatcgagggc
ggcgtgcgcgccattcccccggtgattgccgcgcaactggccgaagggggccggatcgtc
gcgctatttgtcgagggcggattgggtctggtgcgcatcggcaccaaagtcgcgggccag
atccactggcgtttggcgtttaacgctttgttgcccgttctgccgggcttcacaacaaca
gatactttcgccctatag

DBGET integrated database retrieval system