KEGG   Ketogulonigenium vulgarum: KVU_PA0104Help
Entry
KVU_PA0104        CDS       T01909                                 

Definition
chemotaxis protein CheR (EC:2.1.1.80)
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
kvl  Ketogulonigenium vulgarum
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:kvl02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:kvl02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
p1:complement(95905..99027)
Genome map
AA seq 1040 aa AA seqDB search
MLRLSDRFPIVSIGCAQSALPALETFFETLEPNPGFAIVIVMHLEELRDSDVCDAIAGWT
GMPVAVAAADTPVASNTVYIMPADAILTIEDGVLRSNAPDMAKRERKPVDVFFADLAQDQ
REYAVGVILSGGNADGTLGAKAIREAGGLTLAQSLDDDEALNPDMPQSAISINIIDLAIP
VEEIPDRLRIFARSFDTLEAVSRASDELTRTDLQRAHREICAILAGHSTHDFSGYKTKTF
FRRVRRRMQVQQSETLDNYIDLLRKDPTEVTNLFRDLLINVTSFFRDEDAFKLLEKEIIP
KLFEHKKSSDTLRIWVPGCATGEEVYSIAILMREFIERHPNAPRVQIFATDIDEAALSVA
RAGRYPEALLDGLSAERRRRYVRPDGASFVIINEVREMCVFSPHSLVRDPPFSRMDMVSC
RNLLIYFGPEVQRDVIPVFHYSLRPRGYLFLGSSESIGKHSHLFSTLDKKHRIFQARDHS
PKALRLTSNVSHNRSFLFTDASASSQKERDTSLRSKVESRILERFAPAHVVVNSDADIVY
YSAGTSPFLEAPQGVPSRQLMTLARKGLRLDLRAALSECVSTQKRVTRQNLLAERESDEV
QIVDFTIEPISDRAGAEQLYLVVFEAKSPPSAQALGGQYSLSDDRHTELEHELRDTKERL
QSTIEEYETALEELKSSNEELVSVNEEVQSSNEELEASKEEMQSLNEELNTINSELNGKI
EELDRANNDLRNLFESTRIATIFLDRGLVIRTFTPEAAQFFNLRTNDVGRPLTELSSQLD
YPSLSEDIRAVFASGDALDHHVAKDRDGQQYLVRVIPYRTDGNEIDGVIVTFVDVTQLAE
AEHMQHVLVEELNHRVKNLLLVVGSIAKRTIEKSQSVSTFERAFSGRLAALSRAYGSLSR
DQWVDSSIADIFTAELAPFGHSAFHIEGPDLSLPVQIGLSLTMVAHELTTNAAKYGALSV
DAGLVKVQWQFENSQLTIDWSETGGPGAKEPSENGFGFELLEGEISYRLSGEIKKVYEKT
GFRATITIPLSPYATEKSKF
NT seq 3123 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgcttgtctgacaggtttcctatcgtctcaatcggttgcgcccaaagcgccctt
cccgcgctcgagacatttttcgagacgctcgagccgaacccggggttcgccatcgttatt
gtgatgcacctagaggagcttcgcgacagcgatgtttgcgacgccatcgcaggctggacc
ggtatgcccgtcgctgtcgcagccgcagatacgcctgttgcgtctaacaccgtttacatc
atgcccgcggatgcaatcctgacgatcgaggatggcgtgctgcggtcaaacgcgccggac
atggccaagcgcgagcgtaagcccgtggatgtgttctttgccgaccttgcccaagatcag
cgcgaatatgccgttggggtcatactttcgggcggaaacgcagacggaaccttgggcgcc
aaggccattcgcgaagcgggcggtctgacgcttgcccaatcccttgatgatgacgaagcg
ctcaaccctgacatgccgcaaagcgctatcagcatcaacatcatcgaccttgccatccct
gtcgaagaaatccccgaccgccttcggatttttgcacgcagctttgacacgctggaggcc
gtaagccgcgcaagcgacgagttgacccggacggatctgcagcgtgcgcatcgtgaaatc
tgcgccatacttgcaggccactcgacccatgacttttcaggctacaaaaccaagacgttt
ttccggcgtgttcgcagacggatgcaggttcagcaaagcgagacactggacaattatatt
gatttgttgcgcaaggacccgacagaggtaacgaacctttttcgtgatcttctgatcaac
gtcacgagcttttttcgggacgaagacgcgttcaagttactggaaaaagagattattccg
aaacttttcgaacataaaaagtcttctgataccctgcgcatttgggtgcccggatgtgca
acgggcgaagaggtctattccattgcaatcttgatgcgcgaattcattgagcggcatccg
aatgccccgcgcgtgcagatatttgcgaccgacatcgacgaggctgcactctctgttgcg
cgcgccgggcgctatccagaggcattgctcgacggcctgtcggcggagcgtcgtcggcgc
tatgtgcgccccgatggcgcgagctttgtgatcatcaacgaagtgcgcgagatgtgtgtt
ttctcgccccatagtctggtgcgcgacccgccgttttcgcgcatggatatggtgtcgtgc
cgtaatctactgatctattttggccccgaggtgcagcgcgatgtgatcccggtgtttcac
tattctttgcgcccgcgtgggtatctgtttcttggcagctcggaaagtattggcaaacat
agccatctttttagcacgctcgataaaaagcaccgtattttccaggcccgcgaccattcg
ccaaaagcgctgcgactgacgtcgaatgtcagccacaatcggtctttccttttcacggat
gccagcgcgagctcgcaaaaggagcgggacacctcgctgcgaagcaaagtggaatcccgc
attctggaacggtttgcccccgcgcatgttgtggtgaactctgatgcggatatcgtttat
tattctgcgggaacctcgccctttctagaagcgccccaaggcgttccgagccgtcaattg
atgaccctcgcacgaaaggggctacgtctggatctgcgcgctgcgctaagtgaatgcgtt
tcaacgcaaaaaagggtgacgcgccaaaatctgctggccgaacgcgaaagcgatgaggtg
caaatcgtagatttcaccatcgagccaatcagcgatcgggccggtgcggaacagctctat
cttgttgtgttcgaggcgaagtccccgccatccgcacaggcactgggtggccagtacagc
ctgtcggacgaccggcacacagagcttgaacacgagttgcgggataccaaagaacggctt
caatcaacgattgaagaatacgaaacagcgcttgaagagcttaaatcctcgaatgaggag
cttgtttctgtgaatgaagaagtccaatcaagtaacgaagagctggaggcatccaaagag
gagatgcagtcgctcaacgaagaattaaataccataaattccgaattgaacggaaagatt
gaggagctagatcgcgccaataatgatttgcgcaatctttttgaaagcacccgcattgca
acgatcttcttggatcgtggacttgttattcgtacctttacacctgaagccgcccaattc
ttcaatctgcgcacgaatgatgtcggtcgccccctgacagaactgtccagccaactcgat
tatcccagcctgagcgaagatataagagccgttttcgcctcgggcgatgctttggatcat
catgtcgcaaaagaccgcgacgggcagcaatatcttgtgcgcgttatcccataccgcacc
gacgggaacgaaatagatggtgtgatcgtcacttttgtagatgttacacaattggccgaa
gccgagcatatgcagcatgttctggtggaggaactcaaccatcgtgttaaaaacctgctc
ctcgtcgtgggatctattgccaagcgcacgattgaaaagtctcaatccgtttcaacattt
gagcgcgcgtttagtggacgattggcggccttaagccgcgcatatggatctctctcgcgg
gatcaatgggtcgattcctcgatcgctgacatattcactgcggaacttgcgccgtttggg
catagtgcttttcacattgagggccccgatttatcgctgccggtgcaaatcggtctttca
ctcaccatggtcgcccacgagttaacaacgaatgcggccaaatatggcgcgctttcggtc
gatgcgggtctggtgaaagtgcaatggcagttcgagaacagccaacttacgattgattgg
tcggaaacgggtgggccgggcgcgaaagagccgtctgaaaacggctttggattcgaattg
ctagagggcgaaatatcttatcgcctcagcggtgagatcaagaaggtttatgaaaagacc
ggatttcgtgcgacgatcacgatccccctgtcgccctatgccactgaaaagtctaaattt
tag

DBGET integrated database retrieval system