KEGG   Ketogulonicigenium vulgare Y25: EIO_0113Help
Entry
EIO_0113          CDS       T01338                                 

Definition
dihydrolipoamide acetyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
kvu  Ketogulonicigenium vulgare Y25
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:kvu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    EIO_0113
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    EIO_0113
  Amino acid metabolism
   00310 Lysine degradation
    EIO_0113
Enzymes [BR:kvu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     EIO_0113
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(106380..107321)
Genome map
AA seq 313 aa AA seqDB search
MKPVPEATARKGDDAPSARKLMAENNIEASAVAGSGRDGRVMKGDVLAALVSAPAAPLVS
APAAPAPAAAPAAPRAASRADDAPREERVKMTRLRQTIARRLKEAQNTAAMLTTYNEVDM
TAIMDLRNQYKDLFEKKHGVKLGFMSFFAKACAHALAEVPEVNAEIDGDSVIYKRYVHMG
VAGGHGLVVPVVRDTDTKSFAQIEKEIAGFGRKARDGKLSIEDMQGGTFTISNGGVYGSL
MSSPILNPPQSGILGMHKIQDRPIALNGQVVIRPMMYLALSYDHRIVDGQGAVTFLVRVK
EALEDPRRLLMDL
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
gtgaagcccgtccccgaggccaccgcccgcaagggcgatgacgccccctcggcgcgcaag
ctgatggcggaaaacaatattgaggccagcgccgtcgcaggctcgggccgcgatggccgc
gtgatgaaaggcgatgtcctggccgcattggtcagcgcacctgccgcgcccttggtcagc
gcccctgccgcgcccgcacctgccgcggcccccgccgcgccgcgcgccgccagccgcgcc
gatgatgcgccgcgcgaggaacgcgtaaagatgacccgcctgcgccagaccatcgcgcgc
cggttgaaagaggcgcaaaacaccgccgccatgctgaccacctataacgaggtggacatg
acggcgatcatggatttgcgcaatcaatacaaagacctgtttgaaaagaaacacggcgtg
aagctgggctttatgtcctttttcgccaaggcctgcgcccatgctttggccgaagtgccc
gaggtgaatgccgagatcgacggcgattcggtgatctacaaacgctatgtccatatgggc
gtggcgggggggcatggtctggtggttcccgtcgtgcgcgacaccgataccaaatccttt
gcgcagatcgagaaagagatcgcaggctttggccgcaaggcgcgcgatggcaaactctcg
atcgaggatatgcagggcggcacctttaccatctcgaatggtggtgtgtatggctcgctg
atgtcctcgcccattttgaacccgccgcaatcgggcattctgggcatgcacaagatccag
gatcgccccatcgccctgaatggccaagttgtgatccggccgatgatgtatctggctttg
tcctatgatcaccgtattgtggatggtcagggggcggtgactttccttgtgcgcgtgaaa
gaagcgctggaagatccgcgccgcctgttaatggatctgtaa

DBGET integrated database retrieval system