KEGG   Ketogulonicigenium vulgare Y25: EIO_0113Help
Entry
EIO_0113          CDS       T01338                                 

Definition
(GenBank) dihydrolipoamide acetyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
kvu  Ketogulonicigenium vulgare Y25
Pathway
kvu00020  Citrate cycle (TCA cycle)
kvu00310  Lysine degradation
kvu01100  Metabolic pathways
kvu01110  Biosynthesis of secondary metabolites
kvu01120  Microbial metabolism in diverse environments
kvu01130  Biosynthesis of antibiotics
kvu01200  Carbon metabolism
Module
kvu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
kvu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:kvu00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    EIO_0113
  Amino acid metabolism
   00310 Lysine degradation
    EIO_0113
Enzymes [BR:kvu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     EIO_0113
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding
Motif
Other DBs
NCBI-ProteinID: ADO41303
UniProt: E3EX59
Position
complement(106380..107321)
Genome map
AA seq 313 aa AA seqDB search
MKPVPEATARKGDDAPSARKLMAENNIEASAVAGSGRDGRVMKGDVLAALVSAPAAPLVS
APAAPAPAAAPAAPRAASRADDAPREERVKMTRLRQTIARRLKEAQNTAAMLTTYNEVDM
TAIMDLRNQYKDLFEKKHGVKLGFMSFFAKACAHALAEVPEVNAEIDGDSVIYKRYVHMG
VAGGHGLVVPVVRDTDTKSFAQIEKEIAGFGRKARDGKLSIEDMQGGTFTISNGGVYGSL
MSSPILNPPQSGILGMHKIQDRPIALNGQVVIRPMMYLALSYDHRIVDGQGAVTFLVRVK
EALEDPRRLLMDL
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
gtgaagcccgtccccgaggccaccgcccgcaagggcgatgacgccccctcggcgcgcaag
ctgatggcggaaaacaatattgaggccagcgccgtcgcaggctcgggccgcgatggccgc
gtgatgaaaggcgatgtcctggccgcattggtcagcgcacctgccgcgcccttggtcagc
gcccctgccgcgcccgcacctgccgcggcccccgccgcgccgcgcgccgccagccgcgcc
gatgatgcgccgcgcgaggaacgcgtaaagatgacccgcctgcgccagaccatcgcgcgc
cggttgaaagaggcgcaaaacaccgccgccatgctgaccacctataacgaggtggacatg
acggcgatcatggatttgcgcaatcaatacaaagacctgtttgaaaagaaacacggcgtg
aagctgggctttatgtcctttttcgccaaggcctgcgcccatgctttggccgaagtgccc
gaggtgaatgccgagatcgacggcgattcggtgatctacaaacgctatgtccatatgggc
gtggcgggggggcatggtctggtggttcccgtcgtgcgcgacaccgataccaaatccttt
gcgcagatcgagaaagagatcgcaggctttggccgcaaggcgcgcgatggcaaactctcg
atcgaggatatgcagggcggcacctttaccatctcgaatggtggtgtgtatggctcgctg
atgtcctcgcccattttgaacccgccgcaatcgggcattctgggcatgcacaagatccag
gatcgccccatcgccctgaatggccaagttgtgatccggccgatgatgtatctggctttg
tcctatgatcaccgtattgtggatggtcagggggcggtgactttccttgtgcgcgtgaaa
gaagcgctggaagatccgcgccgcctgttaatggatctgtaa

DBGET integrated database retrieval system