KEGG   Ketogulonicigenium vulgare Y25: EIO_0121Help
Entry
EIO_0121          CDS       T01338                                 

Gene name
sdhD
Definition
(GenBank) succinate dehydrogenase, hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
kvu  Ketogulonicigenium vulgare Y25
Pathway
kvu00020  Citrate cycle (TCA cycle)
kvu00190  Oxidative phosphorylation
kvu00650  Butanoate metabolism
kvu01100  Metabolic pathways
kvu01110  Biosynthesis of secondary metabolites
kvu01120  Microbial metabolism in diverse environments
kvu01130  Biosynthesis of antibiotics
kvu01200  Carbon metabolism
Module
kvu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
kvu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
kvu_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:kvu00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    EIO_0121 (sdhD)
   00650 Butanoate metabolism
    EIO_0121 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    EIO_0121 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt DUF766
Motif
Other DBs
NCBI-ProteinID: ADO41311
UniProt: E3EX67
Position
114996..115379
Genome map
AA seq 127 aa AA seqDB search
MRYLTDRKRAVGNGASRTGTFDHIFMTSTSYGLLVLVPCLVWVLGNALFLPFDQARAYVG
RPFPLIVLGLTLVVGLRHFAVGAQMMLEDYLQGFAREITVLIARGLSWLLIATGLLALVR
LALGQPS
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atgcgttatttgacggatcgcaaacgtgccgttggcaatggcgcatcgcgcacgggcacg
tttgaccatattttcatgacctcgacatcttatggcttgctggtgctggtgccttgcctg
gtctgggtgctggggaatgcgctgttcctgccgtttgatcaggcgcgcgcctatgtcggt
cggccgtttccgctgatcgtcttgggtttgacgctggtggtcggtctgcgccactttgct
gtcggcgcacagatgatgctggaagattacctgcagggctttgcccgtgaaattaccgtg
ctgatcgcccgcggcctgtcgtggctgctgatcgcgaccggcctgttggcgctggtgcgt
ctggcgctgggccaaccttcatga

DBGET integrated database retrieval system