KEGG   Ketogulonicigenium vulgare: EIO_0275Help
Entry
EIO_0275          CDS       T01338                                 

Definition
beta-N-acetylhexosaminidase protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
kvu  Ketogulonicigenium vulgare
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:kvu00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:kvu00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
250431..251453
Genome map
AA seq 340 aa AA seqDB search
MTSTPLALSIGMPGLALDADEIAFLREANPYALFLFKRNLDNPDQIRRLCAQFRDAVGRP
DAPVFVDQEGGRVTRLDNGNWPLFRPLADFGALARKDMDLAKHALRLSTLAMGSMLSDLS
MNSGAAPVIDLSRSYTHGVMGNRLLDSDPDVVAALGRVIVDAFLEVGQMPMMKHIPGYGH
AAVDPHMELPVVDASLDDLRASDFRPFKALKDTPWAMVAHTLYTQIDAENVATRSAAICN
LIREELEYDGVLISDCITMEALSGTWPERIKGVLDAGYDIALQCQGELGDYQAAAVAARP
LSDATLARIARGDARLGQAHVDARAVHAEVEEIFKTAALA
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgacctcgaccccgcttgccctgtctatcggaatgcccggccttgcgctcgatgcagat
gaaatcgccttcctgcgcgaggcgaacccctatgcgttgttcctgttcaagcggaatctc
gacaatcccgaccagatccgccgcctctgcgcccagttccgcgacgcggtcggccgccct
gatgcgccggtgttcgtcgatcaagagggcggccgcgtcacgcgtctggacaatggcaac
tggccgctgttccgcccgcttgccgattttggcgcattggcgcgcaaggatatggatctg
gcgaaacacgcgctgcgcctgtcgacgctggcgatggggtcgatgctgtcggacttgtcg
atgaacagcggcgcggcgccggtcatcgacctcagccgcagctacacccatggcgtgatg
ggcaaccgcctgctggacagcgaccccgatgttgtcgccgcccttggccgggtgatcgtg
gatgccttcctcgaggtcgggcagatgccgatgatgaaacatattcccggttacggccat
gccgcggtcgatccgcatatggaattgccggtggtcgatgcctcgctggacgatctgcgc
gccagcgatttccgcccgttcaaggcgctgaaagatacgccttgggcgatggtggcgcat
acgctttacacccagatcgacgcggaaaacgtcgcgacgaggtccgccgcaatctgcaac
ttgatccgggaagagctggagtatgacggcgttctgatcagcgattgcatcacgatggag
gcgctgtcgggcacatggcctgagcggatcaaaggtgtgcttgacgcaggttatgacatc
gcgctgcaatgtcagggcgaactcggcgattatcaggccgctgccgtcgccgctcgcccg
ctgtccgatgcgacgctggcccgcattgcacgcggggatgcgcgccttgggcaggcccat
gtcgatgcgcgggccgtccacgccgaagttgaagaaatcttcaagacagccgcgctggcg
taa

DBGET integrated database retrieval system