KEGG   Ketogulonicigenium vulgare Y25: EIO_0326Help
Entry
EIO_0326          CDS       T01338                                 

Definition
di-heme Cytochrome-c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
kvu  Ketogulonicigenium vulgare Y25
Brite
Enzymes [BR:kvu01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     EIO_0326
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(292901..294091)
Genome map
AA seq 396 aa AA seqDB search
MRKQLCLGFGAALAILAAVATAGANGRAPAGANGRYIWPMPAWMPPPPVPAGNPMSAEKV
DLGRHLFYDARLSRDGTVACASCHEQARAFSDGRELAVGIGQTIGIRNAPALANAGYVPQ
LTWANPHLTTLEAQALVPLFGEDPVEMGSNGREADIFAALAADPYYTDAFASAFPDRPVI
DLFTVTRALAAFQRSLISLDSPYDRFKYGGDADAMTPAALRGERLFFDHRFECYHCHGGI
LFTDSQQTARNPAPMLGNHNNGLYNIGGTGAYPARATGLYEFTGLAADMGRFRTPSLRNV
AVTAPYFHDGSAASLREVLDHYAAGGRTISDGPHAGIGAANPFKDGILVGFDASDAEIND
LIAFLESLTDEGFLTNPAYSDPWPADHPARATRMMP
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaagcaactttgccttgggttcggtgcggcgctggcaatccttgccgccgtcgca
accgccggggccaatggacgcgcacccgccggggccaatggacgctatatctggccgatg
cccgcgtggatgccgcccccgcccgtccccgctggcaatccgatgtcagcggaaaaggtc
gatctggggcggcacctgttctatgacgcacggctgtcgcgcgatggcacggtggcctgc
gcctcgtgccacgaacaggcgcgcgcctttagtgacgggcgcgaacttgcggtggggatt
ggccagaccatcggcatccgcaatgcgcccgcactcgcgaatgcgggctatgtgccgcag
ctgacatgggccaacccgcatctgaccacgcttgaggcgcaggcgctggtgccgttgttt
ggcgaagacccggtcgagatgggcagcaatgggcgcgaggccgatattttcgccgccctt
gctgccgatccctattacacggatgccttcgccagcgcctttcccgatcggcccgtgatc
gacctgttcaccgtgacgcgggccttggcagcgtttcagcggtcgctgatctcgcttgat
agcccctatgaccggttcaaatatggcggtgacgccgatgccatgacgcccgccgccctg
cggggcgagcggttgttctttgaccatcggtttgaatgctaccactgccacggcggcatc
ttgttcaccgacagccagcagaccgcgcgcaatcccgcgccaatgctggggaaccataat
aacggtctttataatatcggcggcacgggggcctaccccgcgcgcgccaccggcctttat
gagttcaccggccttgccgctgatatgggccgtttccgcacccccagcctgcgcaatgtc
gcggtgaccgcgccctatttccacgacggatcggccgcgagtttgcgcgaagtgctggac
cattacgccgccggcgggcgcaccatcagtgatgggccccatgccggtatcggggctgca
aacccctttaaagacggcattctggtcggctttgacgcctcggacgccgagatcaacgac
ctgatcgcctttttggaaagcctgacagacgagggctttctgaccaaccctgcctattcc
gatccatggcctgcggatcaccccgcacgcgcaacaaggatgatgccatga

DBGET integrated database retrieval system