KEGG   Ketogulonicigenium vulgare: EIO_0335Help
Entry
EIO_0335          CDS       T01338                                 

Definition
Protein-L-isoaspartate carboxylmethyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
kvu  Ketogulonicigenium vulgare
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
302748..303425
Genome map
AA seq 225 aa AA seqDB search
MQAVIQSSAESDFAALRVTMVDRQVRTSDVTSYPIIAAMLAIPREDFVPDALRDVAYVGA
DLPLAPARTMPEARTLAKMIDGLAIAPDDRALVIGAGLGYGAALVARMAGQVIALEELPH
LAAGAAAALARHKSDARIVQGKLVEGAPEAGPYDVILIEGGVRAIPPVIAAQLAEGGRIV
ALFVEGGLGLVRIGTKVAGQIHWRLAFNALLPVLPGFTTTDTFAL
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgcaggccgttattcaatcatctgccgaatcggattttgcagcactgcgcgtgacgatg
gtggatcgtcaggtgcgcacgtcggatgtgacatcctatccgattatcgccgccatgctg
gccatcccgcgcgaggatttcgtccccgacgccttgcgcgatgttgcctatgtcggcgcg
gatctgccgcttgcgcccgcccgcaccatgcccgaggcccggacgctggcgaaaatgatc
gacgggctggcgattgcgccggatgatcgcgctttggtcattggcgcggggcttggctat
ggcgcggcgctggttgcgcgcatggcggggcaggtcatcgcgctcgaggaattgccgcac
cttgctgcgggcgccgccgccgcgctggcccgtcacaaaagtgacgcgcgcatcgtgcag
ggaaaactggtcgagggggcgccggaagccggaccctatgacgttatattgatcgagggc
ggcgtgcgcgccattcccccggtgattgccgcgcaactggccgaagggggccggatcgtc
gcgctatttgtcgagggcggattgggtctggtgcgcatcggcaccaaagtcgcgggccag
atccactggcgtttggcgtttaacgctttgttgcccgttctgccgggcttcacaacaaca
gatactttcgccctatag

DBGET integrated database retrieval system