KEGG   Ketogulonicigenium vulgare Y25: EIO_0445Help
Entry
EIO_0445          CDS       T01338                                 

Definition
glycosyl hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
kvu  Ketogulonicigenium vulgare Y25
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:kvu00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    EIO_0445
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    EIO_0445
Enzymes [BR:kvu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     EIO_0445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
414138..415814
Genome map
AA seq 558 aa AA seqDB search
MTDQTLRAMLSGAPFNLDQVAIDWVAATHASLSDAEKIGQLFVISSMGFDPTEADRLRDF
APAGITRFFFGDKATEAGFIDQLRCEAKVPLLFSADLEGSRMSLPFGAEAPNPLALAAID
DVDATHEVSTIMAREAAALGMNWSFTPVIDINHAFRSSIVATRSFGADVARVQRHALAAI
DAFQAQGIAATVKHWPGEGFDDRDQHLVTTINPLSLAEWEASFGTLYRAAVDAGVKSVMS
AHIALPAFVREMMADAGVEAFRPASVSRYLNIDLLRGRLGFNGVIVSDATMMAGFGAWGP
RAQMIPEVIENGCDIILFSDDPVEDAGFVAAALADGRLSRARLDEALFRSLGLKASLGLH
KGVPAQQLDLIGTAADRIRAAEITRRAPTLVKDVQGLLPLSVEKHRRIYVYTTGVVSPMH
TAGGPLALVDMLRAEGFEVTVHDRDNAQMNPWKGYDLVLYLMAEETLLSRERIFMNWAGL
AGQFLRAMERPWHDVPTALISFGYPYYLYDAPRMPCVINAYATMDTMQQAVLDGLMGRAP
FTGTSPVDPFCGLPDAPF
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atgacggatcagactctgcgcgccatgctttctggcgcgccgttcaacctggatcaggtg
gcgattgattgggtcgccgccacccatgccagcctgtcggatgcggaaaagatcgggcag
ttgttcgtcatctcctcgatggggttcgacccgaccgaggcggatcgcctgcgcgatttc
gcccccgctggcatcacgcggttcttttttggcgacaaagcgacagaggccggtttcatc
gaccagctgcgctgcgaggcgaaagtcccgttgctcttcagtgccgatctggaaggcagc
cggatgagcctgccgttcggggccgaggcgccgaacccgctggctttggccgctatcgat
gatgtcgatgcaacgcatgaggtctcgaccatcatggcgcgcgaggcggcggctttgggg
atgaactggtcgttcacgccggtcatcgacatcaaccacgccttccgctcgtccatcgtg
gcgacgcgcagctttggcgcggatgtggcgcgggtccagcgtcatgccttggccgcgatt
gatgcgttccaggcgcagggcatcgccgcgacggtgaaacactggccgggcgaggggttt
gacgaccgcgaccagcatctggtcaccacgatcaacccgctgtcgctagcagagtgggag
gcgagctttggcacgctttaccgcgcggcggtcgatgcgggcgtgaaatcggtaatgtcg
gcgcatatcgcgctgcccgcctttgtgcgcgagatgatggcggatgcgggggtcgaggcc
ttccgccccgcttcggtcagccgttacctgaacatcgacctgcttcgcggacgtttgggc
tttaacggtgtcatcgtgtccgatgcgacgatgatggcaggctttggcgcttggggcccg
cgcgcgcagatgatccccgaggtgattgaaaacggctgcgatatcatcctgttctcggac
gatccggtcgaggatgcgggctttgtcgctgcggctttggcggatggtcgcctcagccgc
gcgcgtctggacgaggctttgttccgctcgctggggctgaaggcttcgctcgggctgcac
aagggcgtccccgcgcagcagttggatctgatcggcaccgccgccgaccgcatccgcgcg
gccgaaatcacccgccgcgcaccgacgctggtcaaggatgtgcaggggctgctgccgctg
tctgtcgaaaagcaccgccgaatctatgtctatacgacgggtgttgtctcgccgatgcat
actgctggcgggccgctggcgctggtcgatatgctgcgcgccgaggggttcgaggtcacc
gtccatgaccgtgacaatgcgcagatgaacccgtggaagggctatgaccttgtgctttac
ctgatggccgaggaaaccctgctgtcgcgtgagcgcatcttcatgaactgggcgggcctt
gcgggccagttcctgcgcgcgatggagcgtccatggcatgatgtgccgaccgctttgatt
tcgttcggctatccctattacctttatgatgcgccgcgtatgccctgtgtcatcaacgcc
tatgccaccatggatacgatgcagcaggcggtgctggatgggttgatgggccgcgcgccc
tttacaggcacatcgcccgttgatccgttctgcggtctgcctgacgcgccattctga

DBGET integrated database retrieval system