KEGG   Ketogulonicigenium vulgare: EIO_0505Help
Entry
EIO_0505          CDS       T01338                                 

Definition
cytochrome C
Orthology
K08738  
cytochrome c
Organism
kvu  Ketogulonicigenium vulgare
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:kvu00920]
Environmental Information Processing; Signal transduction; Two-component system [PATH:kvu02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
477962..478402
Genome map
AA seq 146 aa AA seqDB search
MSKLVRPAALFAMTMMGAGVAAPVFAADPEAGARSFARQCTSCHVLRDDGGRMLVGTGAR
TGPNLFGLARRPAGTAEGFVYSTAMQQLAARTMLWDEPSFVAFVTGPGPFLQQRLSDRRA
NSRMAFVVSNPADAADLWAYLSGLGN
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaagctggtgcgccccgcggcgctgttcgccatgacgatgatgggcgctggcgta
gccgcgcctgtctttgcggccgaccccgaggccggtgcccgcagctttgcgcgccaatgc
accagttgccatgtgctgcgcgatgatggcgggcgcatgttggtcggcacgggcgcacgt
accggcccgaacctgtttggcctcgcccgccgccccgccggcactgccgagggctttgtc
tatagcaccgcaatgcagcaattggctgcgcggaccatgctgtgggacgagccgagcttt
gtcgcctttgtcaccggcccgggcccgttcttgcagcagcgacttagtgatcggcgcgcc
aacagccggatggcttttgtcgtatcaaatccagcggatgcagcggatctgtgggcttac
ctcagcggacttggcaattag

DBGET integrated database retrieval system