KEGG   Ketogulonicigenium vulgare Y25: EIO_0541Help
Entry
EIO_0541          CDS       T01338                                 

Definition
(GenBank) protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
kvu  Ketogulonicigenium vulgare Y25
Pathway
kvu00860  Porphyrin and chlorophyll metabolism
kvu01100  Metabolic pathways
kvu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:kvu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    EIO_0541
Enzymes [BR:kvu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     EIO_0541
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     EIO_0541
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase DAO NAD_binding_8 FAD_binding_2 Pyr_redox_2 HI0933_like Pyr_redox FAD_binding_3 FAD_oxidored NAD_binding_9 GIDA Thi4 AlaDh_PNT_C Pyr_redox_3 Lycopene_cycl TrkA_N NAD_binding_7 ApbA Trp_halogenase
Motif
Other DBs
NCBI-ProteinID: ADO41703
UniProt: E3F0K9
Position
complement(519767..521149)
Genome map
AA seq 460 aa AA seqDB search
MTANPTDDVLIIGGGITGLSAAWRLAEAGRRVTVIEAAPRAGGVVETLRDGDWQAELGPN
TLLARPALYETLRDLGALDSVILANGAGARRYLAKGGKLQALPRDPISALLSGLTRPALP
ALFRDLRAKPLDGPDESIASFIRRHFGDYVLRQFIDPFVSGTNGGDPERLSVRAAMPRLA
LAEGAGNGSVVRGMMAARKAAPPAGDMPENWRRALVSFPQGMQSLPRHLADRFTALGGRL
LTGRKVTTLAQSDGGWQVQDDSGTTYHAAQVLVTIPAGFTANLVEGMSLSLADDLRAIPY
APMIAVALGYAAKDVGHPFDGFGGLIPRLEGRRTLGALFASAQFPGRAPEGHHLMNVFLG
GRNDETITALDDDALLAQVQSDLGDLMGLRAPPVWHRIHRMPHAIPQYEVGHLSLLQRID
GAVAQMPGLGLIGSWRDGISVGDCLASGQRAAAALLGQTA
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgacagccaatcccacagatgatgtcctgatcattggcggcgggatcaccgggctgtct
gcggcatggcgtctggccgaggctggccgccgcgtcaccgtgatcgaggccgccccccgc
gcgggcggtgtggtcgagacgctgcgtgatggcgattggcaggcagaactcggcccaaac
acgctgctggcgcgccccgctctttacgagaccttgcgtgatctgggcgcgctggacagt
gtgatcctcgccaatggtgcgggcgcgcggcgctatcttgccaagggcggcaagttgcag
gcgctgccgcgcgatccgatctcggcgctgctgagcggcctcacccgccctgccctgccc
gcgctgtttcgcgatctgcgtgccaagccgctggacggccccgatgaaagcatcgccagc
tttatccgccgccactttggtgattacgtcctgcgtcagttcatcgacccgtttgtctcg
ggcaccaatggcggcgatcctgaacggctatctgtgcgcgccgcgatgccgcgtctggcg
ctggcggaaggcgcgggcaatggatcggtcgttcgcggtatgatggccgcgcgcaaagcc
gccccgcccgcaggcgatatgcccgagaattggcgccgcgcgctggtcagtttcccgcaa
gggatgcaaagcctgccgcgccatctggcggatcgtttcaccgcactgggcggccgtctg
ctgaccggccgcaaggtcacgacgctggcgcaatcggacggcggctggcaagtgcaagac
gatagcggcaccacctatcacgccgcgcaggtgctggtcaccatacccgcaggtttcacc
gccaatctggtcgagggcatgtccctgtcccttgccgatgatctgcgcgctatcccctat
gccccgatgatcgctgtcgcgctgggctatgcggcaaaggatgtcggccatccgttcgat
ggctttggcggcctgattccgcgccttgaggggcggcgcaccctgggcgcgctgtttgcc
tctgcgcaattccccggccgcgcgcccgaggggcatcatctgatgaatgtcttcctcggc
ggtcgcaatgacgagacgatcaccgcgctggatgacgatgcgctgctggcgcaggtccaa
agcgaccttggcgatctgatgggcctgcgcgcgccgcccgtctggcaccgcatccaccgc
atgccccatgctattccgcaatacgaggtcgggcacctgtcgctgctgcaacggatcgac
ggcgcggtcgcgcagatgccgggcctggggctgatcggcagttggcgcgacgggatcagt
gttggcgactgccttgccagcggccaacgcgccgcagccgcgctgctgggccaaaccgcc
tga

DBGET integrated database retrieval system