KEGG   Ketogulonicigenium vulgare: EIO_0541Help
Entry
EIO_0541          CDS       T01338                                 

Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
kvu  Ketogulonicigenium vulgare
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:kvu00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(519767..521149)
Genome map
AA seq 460 aa AA seqDB search
MTANPTDDVLIIGGGITGLSAAWRLAEAGRRVTVIEAAPRAGGVVETLRDGDWQAELGPN
TLLARPALYETLRDLGALDSVILANGAGARRYLAKGGKLQALPRDPISALLSGLTRPALP
ALFRDLRAKPLDGPDESIASFIRRHFGDYVLRQFIDPFVSGTNGGDPERLSVRAAMPRLA
LAEGAGNGSVVRGMMAARKAAPPAGDMPENWRRALVSFPQGMQSLPRHLADRFTALGGRL
LTGRKVTTLAQSDGGWQVQDDSGTTYHAAQVLVTIPAGFTANLVEGMSLSLADDLRAIPY
APMIAVALGYAAKDVGHPFDGFGGLIPRLEGRRTLGALFASAQFPGRAPEGHHLMNVFLG
GRNDETITALDDDALLAQVQSDLGDLMGLRAPPVWHRIHRMPHAIPQYEVGHLSLLQRID
GAVAQMPGLGLIGSWRDGISVGDCLASGQRAAAALLGQTA
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgacagccaatcccacagatgatgtcctgatcattggcggcgggatcaccgggctgtct
gcggcatggcgtctggccgaggctggccgccgcgtcaccgtgatcgaggccgccccccgc
gcgggcggtgtggtcgagacgctgcgtgatggcgattggcaggcagaactcggcccaaac
acgctgctggcgcgccccgctctttacgagaccttgcgtgatctgggcgcgctggacagt
gtgatcctcgccaatggtgcgggcgcgcggcgctatcttgccaagggcggcaagttgcag
gcgctgccgcgcgatccgatctcggcgctgctgagcggcctcacccgccctgccctgccc
gcgctgtttcgcgatctgcgtgccaagccgctggacggccccgatgaaagcatcgccagc
tttatccgccgccactttggtgattacgtcctgcgtcagttcatcgacccgtttgtctcg
ggcaccaatggcggcgatcctgaacggctatctgtgcgcgccgcgatgccgcgtctggcg
ctggcggaaggcgcgggcaatggatcggtcgttcgcggtatgatggccgcgcgcaaagcc
gccccgcccgcaggcgatatgcccgagaattggcgccgcgcgctggtcagtttcccgcaa
gggatgcaaagcctgccgcgccatctggcggatcgtttcaccgcactgggcggccgtctg
ctgaccggccgcaaggtcacgacgctggcgcaatcggacggcggctggcaagtgcaagac
gatagcggcaccacctatcacgccgcgcaggtgctggtcaccatacccgcaggtttcacc
gccaatctggtcgagggcatgtccctgtcccttgccgatgatctgcgcgctatcccctat
gccccgatgatcgctgtcgcgctgggctatgcggcaaaggatgtcggccatccgttcgat
ggctttggcggcctgattccgcgccttgaggggcggcgcaccctgggcgcgctgtttgcc
tctgcgcaattccccggccgcgcgcccgaggggcatcatctgatgaatgtcttcctcggc
ggtcgcaatgacgagacgatcaccgcgctggatgacgatgcgctgctggcgcaggtccaa
agcgaccttggcgatctgatgggcctgcgcgcgccgcccgtctggcaccgcatccaccgc
atgccccatgctattccgcaatacgaggtcgggcacctgtcgctgctgcaacggatcgac
ggcgcggtcgcgcagatgccgggcctggggctgatcggcagttggcgcgacgggatcagt
gttggcgactgccttgccagcggccaacgcgccgcagccgcgctgctgggccaaaccgcc
tga

DBGET integrated database retrieval system