KEGG   Ketogulonicigenium vulgare Y25: EIO_0728Help
Entry
EIO_0728          CDS       T01338                                 

Definition
(GenBank) tryptophan synthase subunit beta
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
kvu  Ketogulonicigenium vulgare Y25
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:kvu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    EIO_0728
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    EIO_0728
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    EIO_0728
Enzymes [BR:kvu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     EIO_0728
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
707427..708653
Genome map
AA seq 408 aa AA seqDB search
MADTLINSFMTGPDDNGRFGDFGGRFVSETLMPVVLALQAEYEKAKTDQTFWDEMDDLWF
NYVGRPSPLYFAERLTTALGGAKIYMKREDLNHTGAHKINNVLGQIILARRMGKTRIIAE
TGAGQHGVATATVCAKFGLKCIVYMGATDVERQAPNVFRMKLLGAEVIPVKSGRGTLKDA
MNDAMRDWVTNVHDTFYCIGTVAGPHPYPAMVRDFQAVIGKETREQILKHEGRLPDTLVA
AVGGGSNAMGLFHPFLDDEAVKIVGVEAGGHGVDDRMEHCASLTGGRPGVLHGNRTFLLQ
DEDGQILEGHSISAGLDYPGIGPEHAWLHSIGRVKYESITDAEALDAFQKCCEYEGIIPA
LESSHALAQVIKMAPGLPQDHIIVMNLSGRGDKDIFTVARHLGVDIQA
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atggccgatacattgatcaatagtttcatgacagggccggatgacaacggtcgtttcgga
gactttggtgggcgtttcgtttccgaaaccttgatgcccgtcgtgcttgcactgcaggcc
gaatatgaaaaagccaaaacagatcagaccttctgggacgagatggacgatctgtggttc
aactacgtcggccgccccagcccgctgtatttcgccgagcgtctgacaaccgcccttggc
ggtgcgaaaatctatatgaagcgcgaggatctgaaccacaccggcgcgcataagatcaac
aacgtgctgggccagatcattctggcacgtcgcatgggcaagacgcggatcatcgccgaa
accggcgcgggtcagcacggtgttgcgaccgcgaccgtctgcgctaaattcggcctgaaa
tgcatcgtctatatgggcgccaccgacgttgaacgtcaggccccgaacgtgttccgtatg
aagctgctgggcgccgaggttattccggtgaagtcgggtcgcggcacgctgaaagatgcg
atgaacgacgcgatgcgcgattgggtgaccaacgtccatgacacattctattgcatcggc
acggttgccgggccgcatccctatcccgcgatggtgcgcgatttccaagccgtcatcggc
aaagagacgcgcgagcagatcctgaaacacgaaggccgtctgcccgatacgctggtggcg
gctgtgggcggtggctcgaacgcgatggggctgttccacccgttccttgatgacgaggcg
gtcaagatcgtcggcgtcgaggcgggcggccacggcgttgacgaccggatggagcattgc
gccagcctgaccggcgggcgcccgggcgtgctgcatggcaaccgcaccttcctgctgcag
gatgaggatggccagattttggaaggccattcgatctcggcaggcctcgattatccgggc
atcgggccggaacatgcctggctgcattcgatcggccgcgtgaaatacgaatcgatcacc
gacgccgaggcgcttgatgccttccaaaagtgctgtgaatacgaggggatcatccccgcc
ctcgaatcatcccacgcactggcgcaggtgatcaaaatggcccccggcctgccgcaggac
catatcatcgtcatgaacctgtcggggcggggcgataaagatatcttcaccgtcgcccgc
caccttggggtggatattcaggcctaa

DBGET integrated database retrieval system