KEGG   Ketogulonicigenium vulgare Y25: EIO_0732Help
Entry
EIO_0732          CDS       T01338                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
kvu  Ketogulonicigenium vulgare Y25
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:kvu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    EIO_0732
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    EIO_0732
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    EIO_0732
Enzymes [BR:kvu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     EIO_0732
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(711343..712134)
Genome map
AA seq 263 aa AA seqDB search
MSRIDAKFAQLRAEGRKAFVSYVMAGDPDYETSLEIVKGLPAAGVDIIELGMPFTDPMAD
GLTIQAAGQRALDGGQTLEKTLDIVRALRKVDNTTPVVMMGYYNPIYSRGVTRFLSDARE
AGIDGLIVVDLPPEEDSELCIPARDYDINFIRLATPTTDNARLPTVLQNTSGFVYYVSVN
GITGTAAASAAAVGPEVARIKAATDLPVIVGFGIRSPEAAESIASVADGCVIGSAIVAQI
ADGKPVSEVLSFVADLAAGAHRA
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcgcattgatgccaaattcgcccagcttcgcgccgaggggcgcaaggcctttgtc
tcttacgtgatggcgggcgaccccgattatgaaacatcgctggagatcgtgaaaggcctg
cccgccgctggcgtcgatattatcgaactgggtatgccctttaccgatccgatggccgat
ggcctgaccattcaggcggcgggccaacgcgcgctggacggcggccaaacgctggaaaag
acactggatatcgtgcgcgcgctgcgcaaggtcgacaatacgacccccgtcgtgatgatg
ggctattacaacccgatctattcgcgcggcgtgacgcggttcctgtccgacgcgcgcgag
gcgggcatcgacggtctgatcgtcgtcgacctgccgcccgaggaagacagcgagctgtgc
atccccgcccgcgattacgatatcaacttcatccgcttggcgacgcccaccaccgataat
gcgcgcctgccgacggtgctgcaaaacacatcgggctttgtctattacgtctcggtcaat
ggcatcaccggcaccgccgccgccagcgccgccgctgtgggtcccgaggttgcacggatc
aaagcggccaccgatctgccggtgatcgtcggtttcggcatccgctcgcccgaggcggct
gaaagcattgcaagtgtcgcggatggctgcgtcatcggctcggccattgtggcgcagatt
gccgacggcaaacccgtctccgaggtgctgtcctttgtcgccgatctcgccgcaggcgcg
caccgggcctaa

DBGET integrated database retrieval system