KEGG   Ketogulonicigenium vulgare Y25: EIO_0774Help
Entry
EIO_0774          CDS       T01338                                 

Definition
(RefSeq) L-threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
kvu  Ketogulonicigenium vulgare Y25
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:kvu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    EIO_0774
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    EIO_0774
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    EIO_0774
Enzymes [BR:kvu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     EIO_0774
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
752170..753558
Genome map
AA seq 462 aa AA seqDB search
MRYISTRGAAPVLTFEQAMMTGLARDGGLYIPETVPQFTADEIAAFAGLSYAEVALRVLT
PFVGDSFQQDELRSLITAAYAGFNHDARAPLVQLAPNHFLLELFHGPTLAFKDFAMQVIG
QLMQAALARSGKRITIVGATSGDTGSAAIEAFRGLANVDVFILFPDGRVSDVQRRQMTTP
SEANVRAIALAGDFDDCQARLKDMFNDFAFRDAVSLAGVNSINWARVLSQVVYYFTAAVS
LGGPMRPVSFTVPTGNFGDIFAGYIARQMGLPIEKLVIATNQNDILHRTLQSGAHTKQGV
NPSISPSMDIQVSSNFERLLFDAYGRDPKVVAEQMRALAEEGGFTVGQGALEFLRDGFAS
GRASEEETLAEIAQTLAETGELICPHTAVAVKVARDYLGTVPMITLATAHPAKFPDAVER
ATGVRPALPAHMADLFDRPERQTKLPNDLSALEAFITEQLNP
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgcgctatatctcgacccggggcgcggcacccgttctgacgtttgaacaggccatgatg
accggccttgcgcgcgacggcggtctgtatattcccgaaaccgtgccgcaattcaccgcg
gacgagatcgcggctttcgcgggcctgtcttatgccgaggtcgcgctgcgcgtgctgacc
ccctttgtcggcgatagctttcagcaagacgaactgcgcagcctgatcaccgctgcctat
gccgggttcaaccacgatgcgcgtgcgccgctggtacagcttgcgccgaaccacttcttg
ctagagctgttccacggcccgacgctggcgttcaaggactttgccatgcaggtcatcggc
cagttgatgcaggcggcgctggcgcgttcgggcaagcgcatcaccatcgttggcgccaca
tccggtgataccggatcggccgcgatcgaggcgtttcgcggtcttgccaatgtcgatgtc
tttatcctgttccccgacggccgcgtgtccgatgtacagcgccgccagatgaccacgccc
tccgaggcaaatgtccgcgccatcgcactggccggtgatttcgacgattgccaggcgcgc
ctgaaagacatgttcaacgactttgccttccgcgatgcggtcagccttgccggtgtgaac
tcgatcaactgggcgcgcgtgctgtcgcaggtggtttactatttcaccgccgccgtcagc
cttggcgggccgatgcgtccggtcagctttaccgtgccgaccggcaatttcggcgatatt
ttcgccggttacatcgcgcgccagatgggcctgccgattgaaaagctggttatcgcgacg
aaccagaacgacatcctgcaccgcacactgcaaagcggcgcgcataccaaacagggggtc
aatccctcgatcagcccctcgatggatattcaggtctcgtcgaatttcgaacgcctgctg
ttcgacgcctatggccgcgatcccaaagtggtggcggaacaaatgcgcgcattggcggaa
gagggcggctttaccgtcggacaaggcgcgctggaattcctgcgcgacggctttgcctcg
ggtcgcgcctcggaagaggaaacgctggccgagatcgcccagacgctggccgagacgggc
gagctgatttgcccccataccgccgttgcggtgaaggttgcgcgtgactatctgggcaca
gtgccaatgatcacattggccaccgcccatcccgcaaaattccccgatgcggtcgaacgc
gccacgggcgtccgccccgcgctgcccgcgcatatggccgatctgttcgaccggcccgag
cgtcagacaaaactgcccaacgacctttcggcgttggaagcctttattacggagcaactg
aacccttga

DBGET integrated database retrieval system