KEGG   Ketogulonicigenium vulgare Y25: EIO_0842Help
Entry
EIO_0842          CDS       T01338                                 

Definition
thymidine kinase
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
kvu  Ketogulonicigenium vulgare Y25
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kvu00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    EIO_0842
Enzymes [BR:kvu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     EIO_0842
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(824600..825190)
Genome map
AA seq 196 aa AA seqDB search
MAKLYFNYSTMNAGKSTVLLQASYNYLERGMQTYLLTAAFDDRAGVGRIESRIGIGADAD
TYRAGDDLFARIRARQAAGEIACVLVDEAQFLTPDQVWQLARAVDDLRVPVMCFGLRVDF
RGELFPGSATLLALADEMREVRTICHCGKKATMVVRYGPDGTVAHDGDQVVIGGNETYVS
LCRRHWRAAMGEDVPF
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atggctaagctttacttcaactattcgacgatgaatgccggcaagtcgacggtgctgctg
caggcgtcctataactatctggaacgcggcatgcagacctatctgctgaccgccgccttt
gacgaccgcgcaggtgtgggccgtattgaaagccgcatcgggatcggtgcggatgccgat
acctatcgcgcgggcgacgatctgttcgcccgcatccgcgcgcgccaagccgcgggcgag
atcgcctgcgtcttggtggacgaggcgcaattcctgaccccggaccaagtctggcaactg
gcccgcgccgtcgatgacctgcgcgtgcccgtcatgtgttttggcctgcgcgtcgatttt
cgcggcgagctattccccggctcggccacgctgctggcactggccgatgaaatgcgcgag
gtgcgcaccatctgtcattgcgggaaaaaggccacgatggtcgtgcgctatggcccagat
ggcaccgtcgcccatgatggcgatcaggtggtgatcggcggcaatgaaacctatgtgtcc
ctttgccgccgtcattggcgcgccgcgatgggcgaggatgtgcccttttaa

DBGET integrated database retrieval system