KEGG   Ketogulonicigenium vulgare Y25: EIO_0898Help
Entry
EIO_0898          CDS       T01338                                 

Definition
(GenBank) cytochrome c, class I
  KO
K08738  cytochrome c
Organism
kvu  Ketogulonicigenium vulgare Y25
Pathway
kvu01100  Metabolic pathways
kvu01120  Microbial metabolism in diverse environments
kvu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:kvu00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    EIO_0898
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3
Motif
Other DBs
NCBI-ProteinID: ADO42046
UniProt: E3F442
Position
878696..879205
Genome map
AA seq 169 aa AA seqDB search
MFGTKTRAAAALMLSIIAALALLLVIRFIADAVYSVGAIHDEPAYFVEVPGAGPRIDPLD
PVEFARIFEAADPVRGESLWRSCRMCHSLEAGDNRTGPSLAGVVGRAVDTAPGFAYSGAL
ERVVTVWTPDRINALIANPRRFAPGTLMTYTGMRNAQDRADLIAFLQGH
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atgtttggcacaaaaacccgcgcagccgcggcgctgatgctgtcgatcatcgcggcgctc
gcgctgctgctggtcatccgtttcatcgcagatgcggtctattcggtcggcgcaatccat
gacgagcctgcgtattttgttgaggttccgggggcggggccgcggatcgatccgcttgat
cccgttgaattcgcccgcatctttgaggcggctgatccggtgcgcggcgaaagcctgtgg
cggtcgtgccgcatgtgccattcgctagaggcgggcgacaaccgcacaggtcccagcctt
gccggtgttgtcgggcgcgcggtcgataccgcccccggttttgcctattccggcgcgctg
gagcgggttgtcacggtttggacacctgaccgcattaatgccctgattgcgaacccgcgc
cggttcgcgccgggcacgctgatgacctataccgggatgcgaaatgcgcaggaccgcgcc
gatctgattgccttccttcaggggcactag

DBGET integrated database retrieval system