KEGG   Ketogulonicigenium vulgare Y25: EIO_1068Help
Entry
EIO_1068          CDS       T01338                                 

Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
kvu  Ketogulonicigenium vulgare Y25
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:kvu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    EIO_1068
Enzymes [BR:kvu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     EIO_1068
Exosome [BR:kvu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   EIO_1068
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1027899..1028897)
Genome map
AA seq 332 aa AA seqDB search
MPPVLAPFPATRLRRNRATPALRALVRETHLDSSDLIWPVFVMDGEDCATDIPSMPGVQR
LSVDRIAKAAVEAEARGIPAMCIFPYTDMSARTEDCALAWSMDNVANRAIRAIKDAAPNI
AVMTDIALDPYNINGHDGFVVDGQILNDETVEALVKMALAQAESGADILGPSDMMDGRIG
AIRTALEGAGHRNVTIMSYAAKYASGYYGPFRDAVGASAALKGDKKTYQMDPANRDEALR
LVARDLSEGADMVMVKPGMPYLDICRQVKDTFGVPTFAYQVSGEYAMLKAAFANGWLDPQ
KVVLETLMSFKRAGCDGILTYFAPEVAEALNG
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgccacccgtccttgccccatttcccgccacccgcctgcgccgcaaccgcgcaacacct
gcgctgcgcgcccttgtgcgcgagacgcatctggacagcagcgatttgatctggccggtg
tttgtgatggacggcgaggattgcgcgacggatatcccctcgatgccgggcgtgcagcgc
ctgtcggtcgatcgcatcgccaaggccgccgtcgaggctgaggcccgcggcatccccgcc
atgtgcatctttccctataccgacatgtccgcccgcaccgaggattgcgccttggcctgg
agcatggacaatgtcgcgaaccgcgccatccgcgcgattaaagacgctgcacccaatatc
gccgtgatgactgatatcgcgctcgacccctataatatcaacggccatgacggctttgtg
gtcgacggccagatcttgaacgacgagaccgtcgaggcgctggtgaaaatggcactggcg
caggccgaaagcggcgccgatattctaggccccagcgacatgatggatggccgcatcggt
gcgatccgcacggcgctggagggcgcgggccaccgcaatgtcacgatcatgagctatgcc
gcgaaatatgcctcgggctattacgggccgttccgcgatgcggtgggcgccagcgctgcg
ctgaaaggcgataaaaagacctatcagatggaccccgccaatcgcgacgaagctttgcgt
ctggtcgcgcgcgatctgtccgaaggggccgatatggtcatggtgaaaccggggatgcct
tacctcgatatctgccgccaggtgaaagatacgttcggggtgccgacctttgcctatcag
gtgtcgggcgagtacgcgatgctgaaggcggcctttgccaatggctggctggacccgcaa
aaggtcgtgctggaaacgctgatgtcgttcaagcgcgccggctgcgacggcatcctgacc
tatttcgcgccagaggtggccgaggcgctaaacgggtaa

DBGET integrated database retrieval system