KEGG   Ketogulonicigenium vulgare Y25: EIO_1167Help
Entry
EIO_1167          CDS       T01338                                 

Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase E2 subunit
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
kvu  Ketogulonicigenium vulgare Y25
Pathway
kvu00010  Glycolysis / Gluconeogenesis
kvu00020  Citrate cycle (TCA cycle)
kvu00620  Pyruvate metabolism
kvu01100  Metabolic pathways
kvu01110  Biosynthesis of secondary metabolites
kvu01120  Microbial metabolism in diverse environments
kvu01130  Biosynthesis of antibiotics
kvu01200  Carbon metabolism
Module
kvu_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:kvu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EIO_1167
   00020 Citrate cycle (TCA cycle)
    EIO_1167
   00620 Pyruvate metabolism
    EIO_1167
Enzymes [BR:kvu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     EIO_1167
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 DEC-1_N
Motif
Other DBs
NCBI-ProteinID: ADO42312
UniProt: E3EZ20
Position
complement(1114555..1115853)
Genome map
AA seq 432 aa AA seqDB search
MSIEILMPALSPTMEEGTIAKWLVAEGDTVKSGDILAEIETDKATMEFEAVDDGVIGKIL
LPAGSEGVKVNTPMAILLEDGETEAAAPKAAAPKVEAAPVEAPKAAPVAAAAAPVEKGDR
VFASPLARRIAADKGLDLNAIAGSGPKGRIVRADVEGATAAKPAEAAKAPAAAAPTPAAP
APVPTSSSADQILKMYQGRDYTEVKLDGMRKTIAARLTEAKQTVPHFYLRRSVNLDALMA
FRADLNAKLGPRGIKISVNDFVIKACAIALQQVPKANAIWAGDRVLQMKASDVSIAVAVE
GGLFTPVIRDADAKSISALSAEMKDLAKRARDKKLQPQDYQGGSFSISNLGMFGVENFDA
VINPPQGAILAVGAGIKKPIVGDDGEITTETPPATLMSLTLSVDHRVIDGALGAHLLTAI
VENLENPLSMLA
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgtcgattgaaattctgatgccggccctctcccccacgatggaggaaggcaccatcgcc
aaatggctggtggccgagggcgacacggtgaaatccggcgacattctggccgagatcgaa
accgacaaagccacgatggaattcgaggctgtcgacgatggcgtgatcggcaagatcctt
ctgcctgcgggcagcgagggcgtgaaagtgaacacgccgatggcgatcctgctggaagac
ggcgaaaccgaagccgccgcccccaaagcggctgcccccaaagtggaagcagcgccggtc
gaagcgcccaaagcagctccggtcgccgccgctgccgcgccggtcgaaaagggcgaccgc
gttttcgcctcgcccctcgcgcgccgcattgccgctgacaagggtctggacctgaacgcc
atcgcaggcagcggccccaagggccggattgtgcgcgctgatgtcgaaggtgccacggcc
gcgaaacccgccgaggccgcaaaggcccctgccgccgccgcgcccacacctgccgcgccc
gcgcccgtccccaccagcagcagcgccgatcagatcctgaaaatgtatcagggccgcgac
tataccgaggtcaagctggacgggatgcgtaaaaccatcgccgcccgcctgaccgaagcc
aagcagaccgtgccgcatttctatctgcgccgctcggtgaacttggacgcgctcatggcc
ttccgcgctgatctgaacgcaaagttggggccgcgtgggatcaagatctcggtcaatgat
ttcgtcatcaaggcctgcgccatcgcgctgcaacaggtgccaaaggcgaatgcgatctgg
gccggtgaccgcgtgctgcagatgaaagcctcggacgtctccatcgccgtcgcggtcgag
ggtggcctcttcacccccgtcattcgcgatgccgacgccaaaagcatctcggccctgtct
gccgaaatgaaggatctggccaagcgcgcccgcgacaagaaactgcagccgcaagattac
caaggcggcagcttctcgatctcgaacctcgggatgttcggggtcgagaatttcgacgcc
gtgatcaacccgccgcagggcgcgatcttggccgtgggtgcagggatcaagaaacccatc
gtgggggatgatggcgaaatcaccaccgaaaccccccccgccacgctgatgtcgctgacc
ctgtcggttgaccaccgcgtcatcgacggcgcactgggcgcgcatctgctgaccgcgatt
gtcgaaaatctggaaaacccgctctcgatgctggcttaa

DBGET integrated database retrieval system