KEGG   Ketogulonicigenium vulgare Y25: EIO_1251Help
Entry
EIO_1251          CDS       T01338                                 

Definition
lysozyme
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
kvu  Ketogulonicigenium vulgare Y25
Brite
Enzymes [BR:kvu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     EIO_1251
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1193104..1193646
Genome map
AA seq 180 aa AA seqDB search
MQKIFAALFAWLQSLFSTPKRAAATSGGAAASLLTAIAVFVGPWEGERLEAYLDRIADPP
VWTVCFGETRAVQQGDSYTSAECQKMLIEALSVYHAGLARCVAALPDQPQGVQVALTSWA
YNVGVGAACGSTLARLANSGDWQAACQQLPRWNRAGGQPVAGLTNRRAAEQRLCLNALEG
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaagatcttcgccgcgctgttcgcgtggcttcaatctctattctcaacgcccaag
cgcgctgcggccacttccggcggcgcggctgcaagtctgctgacggctatcgccgtgttc
gtcggcccgtgggagggcgagcgcctcgaggcttacctcgaccgcatcgctgacccgccg
gtgtggacagtctgctttggcgagacgcgcgccgtccagcagggcgacagctataccagc
gccgaatgccagaagatgctgatcgaggctctgtcggtctatcacgcgggcctcgcgcgc
tgcgtggcggccctgcctgatcagccacagggcgtccaagtcgcgctgacctcatgggcc
tacaacgtgggcgtgggcgcagcctgcggttcgaccctcgcgcgcctcgcaaattccggt
gactggcaggcggcttgccagcagttgccgcgctggaaccgggcaggcggccagcccgtc
gcgggcctgaccaatcgccgcgccgcagagcagcggctttgtctcaacgcattggagggc
taa

DBGET integrated database retrieval system