KEGG   Ketogulonicigenium vulgare Y25: EIO_1356Help
Entry
EIO_1356          CDS       T01338                                 

Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
kvu  Ketogulonicigenium vulgare Y25
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:kvu00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    EIO_1356
Enzymes [BR:kvu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     EIO_1356
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1304055..1304744
Genome map
AA seq 229 aa AA seqDB search
MISGMTDMTTPRQAAPRQGLLIILSSPSGAGKSTLSRRLMAWDETLRFSVSATTRAPRAG
EVDGEHYHFMTRDGFGQLIATDQMLEHAEVFGNYYGSPRGPVEMAMAQGRDTLFDIDWQG
GQQIRNSPLGAAVVSIFILPPSIAELESRLRARAQDSEEVIAKRMRESMNEISHWAEYDY
VLVNEDLDQAEAQLITIIQAERARRSRQPWLNGFTRGLQQEFTLRGTSS
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgatatctggaatgaccgacatgaccacgccgcgccaagccgccccgcgtcaggggctt
ttgatcatcttgtcctcgccttcgggcgcgggaaaatcgacgctgtcgcgccgtctgatg
gcctgggatgagacgctgcgattctcggtctcggccacgacgcgtgcgccgcgggcgggc
gaggtggatggcgaacattaccatttcatgacgcgcgacggctttggccagttgatcgcc
accgatcagatgctggagcatgccgaggtctttggcaattattacggcagcccgcgcggt
ccggtggaaatggcgatggcgcagggccgcgatacgctgttcgacatcgactggcagggc
gggcaacagatccgcaactcgccgctgggggcggctgttgtgtcgattttcatcctgcct
ccctcgattgccgagctggaaagccgtctgcgcgcgcgcgcgcaagacagcgaagaggtg
atcgcgaaacgtatgcgcgaaagcatgaacgaaatcagccattgggcggaatacgattac
gtgctggtcaacgaggatctggatcaggccgaggcgcagctgatcaccatcattcaggcc
gaacgcgcccgtcgcagccgccaaccttggctgaatggctttacgcgcggtcttcagcag
gaatttacattgcgtggcacgtcgtcataa

DBGET integrated database retrieval system