KEGG   Ketogulonicigenium vulgare: EIO_1356Help
Entry
EIO_1356          CDS       T01338                                 

Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
kvu  Ketogulonicigenium vulgare
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:kvu00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1304055..1304744
Genome map
AA seq 229 aa AA seqDB search
MISGMTDMTTPRQAAPRQGLLIILSSPSGAGKSTLSRRLMAWDETLRFSVSATTRAPRAG
EVDGEHYHFMTRDGFGQLIATDQMLEHAEVFGNYYGSPRGPVEMAMAQGRDTLFDIDWQG
GQQIRNSPLGAAVVSIFILPPSIAELESRLRARAQDSEEVIAKRMRESMNEISHWAEYDY
VLVNEDLDQAEAQLITIIQAERARRSRQPWLNGFTRGLQQEFTLRGTSS
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgatatctggaatgaccgacatgaccacgccgcgccaagccgccccgcgtcaggggctt
ttgatcatcttgtcctcgccttcgggcgcgggaaaatcgacgctgtcgcgccgtctgatg
gcctgggatgagacgctgcgattctcggtctcggccacgacgcgtgcgccgcgggcgggc
gaggtggatggcgaacattaccatttcatgacgcgcgacggctttggccagttgatcgcc
accgatcagatgctggagcatgccgaggtctttggcaattattacggcagcccgcgcggt
ccggtggaaatggcgatggcgcagggccgcgatacgctgttcgacatcgactggcagggc
gggcaacagatccgcaactcgccgctgggggcggctgttgtgtcgattttcatcctgcct
ccctcgattgccgagctggaaagccgtctgcgcgcgcgcgcgcaagacagcgaagaggtg
atcgcgaaacgtatgcgcgaaagcatgaacgaaatcagccattgggcggaatacgattac
gtgctggtcaacgaggatctggatcaggccgaggcgcagctgatcaccatcattcaggcc
gaacgcgcccgtcgcagccgccaaccttggctgaatggctttacgcgcggtcttcagcag
gaatttacattgcgtggcacgtcgtcataa

DBGET integrated database retrieval system