KEGG   Ketogulonicigenium vulgare: EIO_1395Help
Entry
EIO_1395          CDS       T01338                                 

Definition
Hydrolase arginase family
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
kvu  Ketogulonicigenium vulgare
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kvu00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    EIO_1395
Enzymes [BR:kvu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     EIO_1395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1337955..1338914
Genome map
AA seq 319 aa AA seqDB search
MALEDAKTQVDQAFTRQSLRGLSHENAFGGAVSFLRRRYSKDLSGVDLAVTGVPFDQAVT
HRTGPRFGPRALREASTLQPYDPPYGWGYDPLSTLSVVDYGDLAFDYAKTAAFPGALTEH
IRGILAAGAGSITLGGDHFITLPILRAYAEKFGPLSVIHFDAHSDLWQDDDPDRIDHGTF
MYKAVREGLVDVSRSLQIGIRTECDDYLGMPYIDARTVHEKGATWVVEQAKSAVGDHPVY
ITFDIDALDPAFAPGTGTPVWGGLASWQAAAILRDLAGINLIGGDVVEVSPPFDPTGATA
VAGAHVAMELIALYGWTRR
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atggcactcgaggacgccaaaacccaggttgatcaggcgtttacgcgccaatctttgcgc
ggcctctcgcatgagaatgcctttggcggggcggtgtctttcctgcgccgccgctatagc
aaggacttgagcggcgtcgatctggccgtgaccggcgtgccctttgatcaggccgtcacg
catcgcaccggcccccgtttcgggccgcgggcgctgcgcgaggcttcgaccttgcagccc
tatgatccgccctatggctggggttatgatccgctatcgacgctgtcggtggtggattac
ggcgatctggcgttcgattacgcgaaaacggcggccttcccgggcgcgttgaccgaacat
attcgcggtattctggcggcgggcgcaggcagcatcacgctgggcggtgaccactttatc
acgctgccgatcctgcgtgcctatgccgaaaagttcgggcccctgtcggtgatccatttc
gacgcgcattccgatctgtggcaggacgacgatccagaccgtatcgaccacggcacattc
atgtataaggccgtgcgcgaagggttggtcgatgtcagccgcagcctgcaaatcggcatc
cgcaccgaatgcgacgattatctgggtatgccctatatcgacgcgcgcactgtccatgaa
aagggcgcgacttgggttgtggaacaggccaaatccgccgtgggcgaccatcctgtatac
atcacattcgatattgatgcccttgatcccgcattcgcgccgggcaccggcacgccggtt
tggggtggtcttgccagttggcaggcggcggcgatcctgcgcgatctggcggggatcaat
ctgatcggcggtgatgtggtcgaggtctcgccccccttcgaccccacgggcgccaccgct
gtcgcgggcgcccatgtggcgatggagctgatcgccctttatggctggacgcgccgctaa

DBGET integrated database retrieval system