KEGG   Ketogulonicigenium vulgare Y25: EIO_1404Help
Entry
EIO_1404          CDS       T01338                                 

Definition
triose-phosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
kvu  Ketogulonicigenium vulgare Y25
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:kvu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    EIO_1404
   01230 Biosynthesis of amino acids
    EIO_1404
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EIO_1404
   00051 Fructose and mannose metabolism
    EIO_1404
   00562 Inositol phosphate metabolism
    EIO_1404
Enzymes [BR:kvu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     EIO_1404
Exosome [BR:kvu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   EIO_1404
  Exosomal proteins of bladder cancer cells
   EIO_1404
  Exosomal proteins of melanoma cells
   EIO_1404
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1346679..1347377)
Genome map
AA seq 232 aa AA seqDB search
MRRKIAAGNWKMFGTVADLSQIAAIATGADKAVDTLICPPATLIAAAAPHAAASFAIGGQ
DCHPLQSGAYTGEISALMLRDAGATHVIVGHSERRRDHAETNDLVRAKAGAALEAGLTAV
ICVGESLEQREAGITLDAITAELEASLPEGCVGGNTIVAYEPLWAVGTGLIPTPQQIAEV
HGRIRAILRARFGHEAEMIRILYFTAARSKPRTRPRFSRPPMSMARWWAARV
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcgtaaaattgctgcgggtaactggaagatgtttggcacggtggcggatctgtcg
cagatcgcagccatcgccacgggcgccgacaaagctgtcgatacgctgatctgcccacct
gccacgctgatcgccgccgccgccccccatgccgcagccagcttcgccatcggcggtcag
gattgccacccgttgcaaagcggcgcctatacgggcgagatttcggccctgatgctgcgc
gacgcgggcgcaacccatgtcatcgtcggccattccgaacgccgccgcgatcatgccgag
accaatgaccttgtccgcgccaaagccggtgccgcattggaagcgggtctgaccgccgtg
atctgcgttggcgaaagcctcgagcagcgcgaagcgggcatcacattggacgccatcacc
gcagaactcgaggcctcgctgcccgagggatgcgtgggcggcaacaccatcgtcgcctat
gagccgctctgggctgtgggtaccggtctgatcccgacccctcagcaaatcgccgaagtg
catggccgcatccgcgctatcttgcgcgcgcgctttgggcacgaggccgagatgatccgc
atcctttactttacggcggctcggtcaaagcctcgaacgcggccgagattttcgcggccg
ccgatgtcgatggcgcgctggtgggcggcgcgagtctga

DBGET integrated database retrieval system