KEGG   Ketogulonicigenium vulgare: EIO_1566Help
Entry
EIO_1566          CDS       T01338                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
kvu  Ketogulonicigenium vulgare
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:kvu00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1505369..1506493)
Genome map
AA seq 374 aa AA seqDB search
MGQSTLDLIARAPGDYAVEVLTGGRNIAQLADDAVKFHAKLAITCEDDLLPDLRAALAGT
GVDVAAGAAAIAEAATRPVDWAMSAIVGVAGLVPGLNIIGQGATLGLANKETLVAAGPLV
VARAAAHHATIIPVDSEHSAIFQALHGEDLAAVERVIITASGGAFRDATLAEMAQATPEQ
AATHPNWAMGQRITIDSASMFNKALEMIEAREFFGLSPDQIEVVVHPESLIHALVGFQDG
ALMAHVGPPDMRHAIGYALHWPARKTLPVERLDLVKIGQMTFRAADPDRYPALRLARQVM
AQGGYAGAVFNAAKERALDRFLNRDLAFLDMAAAVEHVLDQMDRAGLLAGDSLSLDQVLA
MDAEARARVDGYKG
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
gtggggcaaagcacgctggatctgattgcgcgtgcgccgggcgactatgcggtcgaggtg
ctgaccggcggtcgcaatatcgcgcaacttgcggatgatgctgtaaaattccacgcaaaa
cttgcgatcacctgcgaagatgatttgctgcctgacctgcgcgcggcgctggcgggcact
ggcgtcgatgttgccgcaggcgccgccgccattgccgaggctgcaacccgtcccgtcgat
tgggcaatgtctgcgattgtcggtgttgcggggctggtgccggggctgaacattatcggg
cagggcgcgacactcggccttgcgaataaagaaacattggttgccgcaggccccttggtg
gtggcgcgggcggccgcgcatcatgccacgatcatccccgtcgatagcgaacatagcgcc
atctttcaggcgctgcacggcgaggatctggccgcggtcgagcgtgtcatcatcaccgca
tcgggcggcgcatttcgtgatgcgacgctggccgagatggcacaagccacccccgaacag
gcggcaacccatcccaattgggctatggggcagcggatcacgatcgattccgcctcgatg
ttcaacaaagcgctggaaatgatcgaggcgcgcgaattctttggccttagccccgatcag
atcgaggttgtcgtccatcccgaaagcctgatccacgctttggtcggctttcaggatggc
gcgctgatggcccatgtcggcccgcccgatatgcgtcacgccattggttatgccctgcac
tggcccgcgcgtaaaacgctgccggttgagcggcttgatctggtgaaaattggccagatg
acgtttcgcgcggctgacccagaccgctatcctgcgctgcgccttgcgcggcaggtgatg
gcgcagggcggctatgccggtgctgtgttcaacgccgccaaggaacgcgcgcttgaccgc
tttctcaatcgtgatctggcttttctggacatggccgctgcggtggaacatgtgctggat
cagatggatcgtgcagggcttttggcgggcgatagtctatcgcttgatcaggtcttggcc
atggacgccgaggcgcgcgcccgcgtcgatggatataaaggatag

DBGET integrated database retrieval system