KEGG   Ketogulonicigenium vulgare Y25: EIO_1676Help
Entry
EIO_1676          CDS       T01338                                 

Definition
DNA polymerase III subunit chi
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
kvu  Ketogulonicigenium vulgare Y25
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:kvu00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    EIO_1676
   00240 Pyrimidine metabolism
    EIO_1676
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    EIO_1676
   03430 Mismatch repair
    EIO_1676
   03440 Homologous recombination
    EIO_1676
Enzymes [BR:kvu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     EIO_1676
DNA replication proteins [BR:kvu03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     EIO_1676
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1612394..1612852)
Genome map
AA seq 152 aa AA seqDB search
MAEIQFFQLFDGPVAATLPVLLNRSLERGWRVILRGTDPARMAALDVDLWRRDDDGFLPH
GLAGGPHDALQPVLLTTGDGLPDGDCLICVDMATATPAECASLERVVLIFDGHDPQALDH
ARGEWKALTGQGVPASYFAQEDGRWVKKAERA
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
ttggccgaaatccagttctttcaattgtttgacgggcctgtggcggcaacgctgccagtg
ctgctgaaccggtcgctggaacgcggctggcgggtgatcctgcgcggcaccgatcccgcg
cggatggcagcgctggatgtggatctgtggcggcgcgatgatgacggctttctgccgcac
ggtcttgcaggcgggccgcatgatgcgctgcagccggtgctgctgaccacaggcgacggc
ctgccggacggcgactgtctgatctgcgtcgatatggcgacggccaccccggctgaatgt
gccagccttgaacgcgttgtgctgattttcgacggccacgaccctcaggcgctggaccat
gcgcgcggcgaatggaaagcgctgacggggcagggcgtccccgccagctatttcgcccaa
gaggacggccgctgggtgaaaaaggccgagcgcgcctag

DBGET integrated database retrieval system