KEGG   Ketogulonicigenium vulgare Y25: EIO_1719Help
Entry
EIO_1719          CDS       T01338                                 

Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
kvu  Ketogulonicigenium vulgare Y25
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:kvu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    EIO_1719
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EIO_1719
   00052 Galactose metabolism
    EIO_1719
   00500 Starch and sucrose metabolism
    EIO_1719
   00520 Amino sugar and nucleotide sugar metabolism
    EIO_1719
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    EIO_1719
   00524 Butirosin and neomycin biosynthesis
    EIO_1719
Enzymes [BR:kvu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     EIO_1719
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1655314..1656261
Genome map
AA seq 315 aa AA seqDB search
MTTELSLVADIGGTNTRLALSAAGVVLHDTVRRFQNEGRQLNDILDEYLAECCPDTKPHS
ACFALAGPISGDTGRMTNLAWTIHAPEIATRTSANRCILINDLQAQGYALPALAPDQLTP
VLSAERDIRAPRLVVGLGTGYNAAFVLPIESGVLVPAAEAGHASLPAHTADGRKVVDWLL
ANLGQAQVEDALSGTGFAHIHAALHGEKATPPALLARCEDGEAKALKTLEVAIELLGGVV
GDLALIFLPRGGIYLTGGFGQALTPWLRQPHLQTVFHDAFAAKGKISAIMQDFALSVIGD
DFAALEGCALRVAQN
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgacgactgaactctctcttgttgcggatatcggtggaacgaacacgcgcctcgcgcta
tcggcggcgggcgttgtgctgcatgatacggtgcgccgttttcagaacgaaggccggcag
ctgaatgatattctggatgaatatctggcggaatgctgccccgataccaaaccccacagc
gcctgtttcgcgctggccgggccgatcagcggtgatacgggccggatgacaaacttggcc
tggaccatccatgcgcccgagattgccacccgcacatcggcgaatcgctgcattttaatc
aatgacttgcaggcacagggctatgcgctgcccgcccttgcgcccgaccaactgacgccg
gtgctgtctgccgaacgcgacatccgcgcgccgcgtttggtcgtcggccttggcaccggc
tataacgccgcctttgtgctgccgattgaatcgggcgtgttggttcctgcggccgaggcg
ggccatgcctcgctgcccgcccatacggcggacggccgcaaggttgtcgactggcttttg
gcgaacctgggccaagcacaggtcgaggacgcgctatctggcaccggattcgcccatatc
cacgccgcgctgcacggcgagaaagccacgccccccgcgctgctcgcgcgctgtgaggat
ggcgaggcaaaggccctgaagacgctggaagtcgcgatcgagctgctgggcggggttgtg
ggtgaccttgcgctgatcttcctgccgcgcggcggtatctatctgaccggcggctttggg
caggccctgacgccctggctgcgccagccgcatctgcaaacggtctttcacgacgccttt
gccgccaagggcaagatcagcgccatcatgcaagatttcgcgctttcggtgatcggcgac
gatttcgccgccctcgaaggctgcgccttgcgcgtcgcgcagaactaa

DBGET integrated database retrieval system