KEGG   Ketogulonicigenium vulgare: EIO_1737Help
Entry
EIO_1737          CDS       T01338                                 

Definition
malate synthase G
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
kvu  Ketogulonicigenium vulgare
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:kvu01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:kvu00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:kvu00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1674643..1676775)
Genome map
AA seq 710 aa AA seqDB search
MMQSYVTRAEISVADQLAQFIEDDVLPGTGVTPEGFWAGLSVLVNDYGAENAALLEARAH
LQSQIDDWHIAYRGKPHDADAYQDFLREIGYIVPEGPDFTIETPQTDPEFATLAGPQLVV
PITNARFALNAVNARWGSLYDALYGTDALGDLPPAGGVDAARAAKVIGWVRSHLDKVLPL
AGGSWHQAGALAVTDGAFGAGGLPLRDPAQFTGYSGGTFLFNSNGLGIEIQVNPEDQNAM
DDPSAIADVRVEAALTAIMDCEDSVATVDAADKVLAYRNWLGLMRGDLSETFEKGGRKIT
RRISADRILNAPDGQPLTVRQRSLMLVRNVGHLTTNPFVRDKNGADAFEGLVDAAVTVLI
AKHDLARGTAQNSVTGSVYVVKPKMHGPAEVAFATRVFDYVEDMLALPRETVKLGIMDEE
RRTSVNLKECIRAAKRRVAFINTGFLDRTGDEIHTSMEAGPMLPKGEMKSQPWIQSYEMR
NVDIGLACGLRGRAQIGKGMWAMPDRMGEMLAQKIGHPQAGANCAWVPSPTAAVLHALHY
HLVDVAARQAEIAAGGPRGTLTDLLTIPTAVGRNFTPTDIARELDNNAQGILGYVVRWID
QGIGCSKVPDIHDVGLMEDRATCRISAQALANWLHHGVLTQDQVMEAFRRMAAVVDRQNA
GDADYVPMAPDFGGLAFQAACDLVFLGRELPAGYTEPVLHRRRLQRKTQL
NT seq 2133 nt NT seq  +upstreamnt  +downstreamnt
atgatgcaaagctatgtgacacgcgccgagatctcggtcgcagatcaattggcgcagttt
atcgaggacgatgtcctgcccggcacgggtgtgacgcccgaggggttctgggcgggcctg
tcggtgctggtgaatgactatggtgccgagaatgccgccctgttggaggcgcgggcgcat
ctgcaaagccagatcgacgattggcacatcgcttatcgtggcaagccgcatgacgcggac
gcctatcaggatttcctgcgcgagattggttatatcgtgcccgaggggccggatttcacc
attgaaacgccgcagactgacccggaattcgcaacgctggcggggccgcaattggtggtg
ccgatcaccaatgcgcgctttgcgctgaacgctgtgaatgcgcgctggggctcgctttat
gatgcgctgtacggcaccgatgctttgggtgatctgccgcccgcaggcggtgttgatgcg
gcgcgcgcggccaaggttatcggttgggtgcgcagccatttggataaggtgctgccgctg
gcgggcggtagctggcatcaggcgggtgccttggctgtgacggatggcgcctttggcgcg
ggcggtctgccactgcgcgatcctgcgcagttcactggctattccggcggcactttcttg
ttcaattccaacggccttggcatcgaaattcaggtaaaccctgaagatcagaacgccatg
gatgacccctctgccatcgccgatgtgcgggtcgaggcggcgctgacggctatcatggac
tgcgaggattccgtcgccaccgtcgatgccgccgacaaagtgctggcctatcgcaactgg
ctgggtctgatgcgcggcgatctgtccgagaccttcgaaaagggcgggcgcaagatcacc
cgtcgcatcagtgccgatcgcattttaaacgcgcccgatggtcagcccctgacggtgcgc
cagcgcagcctgatgcttgtgcgcaatgtcggacatctgacgacgaacccgtttgtgcgc
gacaagaatggcgccgatgcgttcgaggggctggtcgatgccgccgtcaccgtgttgatt
gcgaagcacgatctggcccgcggcactgcgcaaaattcggtcaccggctcggtctatgtg
gtgaagccgaaaatgcacgggccggccgaggtcgcctttgccacccgcgtctttgattat
gtcgaggatatgctggccctgccgcgcgagacggtgaaactggggatcatggacgaggag
cgtcgcacctcggttaatctcaaggaatgtatacgcgccgccaaacgccgcgttgccttc
atcaataccggctttctggatcgcaccggcgacgagattcatacctcgatggaggcgggc
ccgatgctgcccaagggcgagatgaaatcgcagccctggattcaatcctatgagatgcgc
aacgtcgatatcggcctggcctgcgggctgcgcggccgcgcgcagatcggcaagggcatg
tgggcgatgcccgatcgcatgggcgagatgctggcgcaaaagatcggccatccgcaggcg
ggcgcgaattgcgcctgggtgccgtcgcccactgcggcggtcttgcacgcgctgcattat
catctggtcgatgtcgccgcccgtcaggcggaaatcgccgcaggcggcccgcgcggcacg
ctgacggatctgctgaccatcccgaccgccgtggggcgcaatttcacgcccacagatatc
gcgcgcgagttggacaataacgcgcagggcattctgggctatgtggtgcgctggatcgat
caggggattggctgctcgaaagtgcctgatatccatgatgttggtttgatggaggatcgc
gccacttgccgcatctcggcgcaggctttggcgaattggctgcatcacggcgtcctcacg
caggatcaggtgatggaggcctttcgccgcatggccgctgtggttgatcgccagaatgcg
ggtgatgcggattacgtgccaatggcgcctgattttggcggcctcgcgttccaagctgcc
tgcgatctggtctttttggggcgcgaactgcctgcaggttataccgaacccgtgctgcac
cgccgccgtttgcagcgaaaaacccagttgtga

DBGET integrated database retrieval system