KEGG   Ketogulonicigenium vulgare: EIO_1959Help
Entry
EIO_1959          CDS       T01338                                 

Definition
1,4-alpha-glucan-branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
kvu  Ketogulonicigenium vulgare
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:kvu00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1915183..1917216)
Genome map
AA seq 677 aa AA seqDB search
MPDAAAVFLCCDDGKTPMQQHPDAAGLWTATMPVAPSYRFEAHFLDGAVYGWQDAYRYGS
LFHDKWSQSPNGLRLWHSLGAHCVEVSGVKGTFFAVWAPNARRVSVVGDFNHWDGRRAPM
RLQHGCGIWEIFLPDVTADALYKFEVLGADGIMRLKADPYGQQAERAPGNASIVTMKSAF
AWTDKDWMTTRGSRHSPDAPISIYEIHLGSWRGQGGYEGLCVSLLDYIEDMGFTHIELMP
VHEHPFAGSWGYQPVGLYAPAARYGKPDQLRTFVNAAHSRGIGVILDWVPAHFPEDPHGL
AMFDGTALYEHQDSREGRHPDWGTLIYNFGRREVKDFLTSNALYWLEEFHIDALRVDAVA
SMIYRDYSRPAGEWIPNIYGGNQNLEAIAFLQDLNTAVYREAPGIMMIAEESTSYPGVTR
PVDQQGLGFGYKWNMGWMNDILRYMSRESIHKKYHHHEATFSTVYAGSEHYILPFSHDEV
VHGKKSLLAKMPGDANQQFANLRALYAFMWGHPGKKLLFMGQEFAQSREWNHDENLNWWE
ADQPQGRAMSSFLRDLNRLYRRYPALHGSDRDGFTWVDANADQDSIFVWLRHVPNDPAPV
LIAINMTPVDREVQIGLPRAGNWREILNSDAAVYGGGNLGNLGGISALDMPMQGQPYGAT
LTVPGLSAIWLTPDEQN
NT seq 2034 nt NT seq  +upstreamnt  +downstreamnt
atgcccgatgcggcggcggtattcctatgctgcgatgatggaaaaacgcctatgcagcag
catcctgacgcggcgggtctatggactgcgacaatgccggttgcgccaagctatcgtttt
gaggcgcattttttggatggtgcagtctatggatggcaagacgcttaccgatacggctca
ctttttcacgacaaatggtctcaatcgcctaatggtttgcgtttatggcattctttaggc
gcacattgcgtagaggtatcgggcgtcaagggcacatttttcgcggtgtgggcaccaaac
gcaaggcgcgtcagcgtcgtgggggatttcaatcactgggacggccgccgcgctccgatg
cggctgcagcatggctgcggtatatgggagatattcctgcccgatgtcactgcagatgcc
ctgtataaattcgaggtgttgggtgcggatggtataatgagactgaaggcggacccctat
ggccaacaggccgagcgcgcgccgggcaatgcctccatcgtgacaatgaaatccgcgttt
gcctggacggataaggattggatgacgacacgcggcagccgccactcccctgatgcgccc
atatccatctatgaaattcatcttggatcatggcgggggcagggcggttatgagggactt
tgcgtcagtcttttggattacattgaagacatgggctttacgcatatcgagctgatgcct
gtccatgagcatcctttcgcagggtcgtggggatatcagcccgtcggcctttatgcgccg
gcggcacgatatggcaaacctgaccagctacgcacattcgtaaacgctgcgcatagccgc
ggtataggtgtgatcctcgactgggttcccgcccactttcccgaagatccacatggattg
gccatgtttgatggaacagccctctatgaacatcaggactcacgcgaagggcgccacccc
gattgggggacgctgatctataattttggccgccgcgaagtcaaagattttctaacttca
aatgcactctattggctggaggagtttcacatcgatgctcttcgggtcgatgccgtggcc
tcgatgatctatcgtgattactcacgcccagcaggtgaatggataccaaatatatatggc
ggcaatcaaaacctggaagcgatcgcgtttttgcaggatttgaacacggcagtttatcgc
gaagctcctggaattatgatgattgcagaggaatcgacaagttatcccggtgtcacacgg
ccagtcgatcagcagggcttgggatttggttataagtggaacatgggctggatgaatgac
attctgcgttacatgtcacgcgagtcgatccataagaaataccatcaccatgaagctaca
ttcagcaccgtttatgccggctcggagcattacatcctgcctttcagccatgacgaggtt
gtgcatggcaaaaagtcgcttttggcgaagatgccgggcgacgcgaaccagcaatttgca
aatcttcgggccctttacgcctttatgtggggacatcccggcaagaagttattgttcatg
gggcaggaattcgcgcaaagccgcgaatggaaccatgacgaaaacctgaattggtgggag
gcagaccagccgcagggacgtgctatgtcgtcttttttgcgcgatctgaacaggttatac
cgcagatatccggcccttcatggtagtgaccgcgacggatttacgtgggtagatgcgaat
gcagaccaggactctatctttgtctggttacgccacgtgcctaacgatcccgctcccgtg
ctgattgcgatcaatatgacgcctgtggatcgcgaggtgcagatcggtctgccacgcgca
ggaaattggcgcgaaatcctcaattctgacgcggcggtctatggtgggggtaatcttgga
aatcttggcgggatttcagccctggatatgcctatgcaggggcagccctatggcgcgacg
ctgactgtgccggggctttcggcgatatggctgacgcccgatgagcaaaactag

DBGET integrated database retrieval system