KEGG   Ketogulonicigenium vulgare: EIO_2144Help
Entry
EIO_2144          CDS       T01338                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase motor protein
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
kvu  Ketogulonicigenium vulgare
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:kvu03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2096163..2096819)
Genome map
AA seq 218 aa AA seqDB search
MIGWLSGRIIEKSGDQILLDVRGVGYIIHVSDRVMASLPGVGEAVALYTDLLVREDLMQL
FGFTSRTEKEWHKLLMGVQGVGAKAALAIMGALGGDGLSRALALGDWSSIAKAKGIGPKT
AQRVVMELKGKAPTVMAMSGGAESLDAVIEDDGPAPKPAARRARPVSNAQPDALSALGNL
GYSPSDAAAAVAQAAGEAPDADASALILAALKLLAPKA
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgatcggctggctgtctggacggatcattgaaaaaagtggcgatcagatcctgctggat
gtgcggggggtcggctatatcatccatgtctcggatcgggtgatggccagcctgcccggc
gtgggcgaggcggtggcgctttataccgatctgctggtgcgcgaagatctgatgcagctc
ttcggctttacatcgcgcacggaaaaagagtggcacaagctgctgatgggcgtgcagggt
gtgggggccaaggccgcgcttgcgatcatgggggcgctgggcggcgacgggttgtcgcgg
gcgctggcgctgggcgattggtccagcattgccaaggccaagggcatcggccccaaaacc
gcgcagcgcgtggtgatggagttgaagggcaaggcgccgaccgtcatggccatgtctggc
ggcgcggaaagtctggatgcggtgatcgaggatgacggccccgcaccaaaacctgctgcg
cggcgcgcaaggcctgtgtccaatgcacagcccgatgctttgtctgcgctggggaatttg
ggctatagcccatcagatgcggcggcggcggtggcgcaagcggcgggcgaggcgccggat
gccgatgccagcgcgctgatccttgcggcgctgaagctgctggcgccaaaggcataa

DBGET integrated database retrieval system