KEGG   Ketogulonicigenium vulgare Y25: EIO_2168Help
Entry
EIO_2168          CDS       T01338                                 

Gene name
deoA
Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
kvu  Ketogulonicigenium vulgare Y25
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kvu00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    EIO_2168 (deoA)
Enzymes [BR:kvu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     EIO_2168 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2117742..2119007)
Genome map
AA seq 421 aa AA seqDB search
MLDARGLIVALRDGQGASPDAIRAFARGLADGTVSDAQAGAFAMAVLLRGLGDAGRVALT
AGMRDSGDVLRWDLDRPVLDKHSTGGLGDCVSLILAPALAAAGVAVPMISGRGLGHSGGT
LDKLEAIPGLSVAGDEARLRQLIRDVGCAIVGASGRIAPADKRLYAIRDVSGTVESLDLI
TASILSKKLAAGLQGLVLDVKVGSGAFMRDLAQAKALARALVETANGAGCPTSALITDMN
EPLAPAMGNALEVRAALDVLQGTGGRLRDVTLALAQRLGVDVTAALDTGRALEVFAQMIA
AQGGPANFVPRVDHYLPKAAVIRDLPAPRAGYLGGWAGVDLGLAVVNMGGGRRVEGDVID
PAVGLSDILPIGTPLAAGQAVLRIHARDEASCDITARAVLAAMQITDAPPAARPLILAEV
L
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
gtgttggacgcgcgcgggttgatcgtcgcgctgcgcgacgggcaaggggcttcgcccgat
gcgatccgcgcctttgcgcgcgggctggcggatggcacggtatccgatgcgcaggcggga
gcctttgcgatggcggtgctgctgcgcgggctcggcgatgcgggccgcgtcgcgctgact
gcggggatgcgcgattcgggcgatgtgctgcgctgggatctggaccggccggtgctggac
aagcactcgaccgggggcctcggcgattgcgtctcgctgatcttggcgcccgcgctggcg
gcggcgggtgttgcggtgccgatgatttcggggcgcggccttggccattcgggcggcacg
ctggacaagcttgaggcgatccccggcctgtccgtcgcaggagatgaggcgcgtctgcgc
cagctgatccgcgatgtcggctgcgcgattgtcggcgcatcggggcgtatcgcgcctgcg
gacaagcgcctttatgcgatccgtgatgtgtcggggacggtggaaagtctggatctgatc
accgcttcgatcctgtccaagaaactggcggcggggttgcaggggctggtgctggacgtc
aaggtcggatcgggcgcgttcatgcgcgatctggcgcaggccaaggcactggcgcgcgcg
ctggtggagacagcgaacggggcgggctgcccgacatccgcgctgatcaccgatatgaac
gagcctttggcccccgcgatgggcaatgcgctggaggtccgggccgcgctggatgtgttg
caaggcacgggcgggcgtttgcgcgatgtgacgctggcgttggcgcagcggctgggcgtg
gatgtcaccgcggcgctggacacgggccgcgcgctagaggtgttcgcgcagatgatcgcg
gcgcagggcggccctgcgaacttcgtcccgcgcgtggatcactacctgcccaaggccgcc
gtgatccgcgatttgcctgcgccgcgcgcgggctatctgggggggtgggccggggtcgat
ctgggccttgcggtggtgaatatgggcggcgggcggcgggtcgagggcgatgtcatcgac
cccgccgtcgggctgtcggatatcttgccgatcgggacgccgttggccgcggggcaggcg
gtgctgcgcatccatgcgcgggatgaggcgtcctgtgacatcacggcgcgcgccgtgctg
gcggcgatgcagatcaccgatgcgccccctgcggcgcgcccgctgatcttggccgaggtg
ctctga

DBGET integrated database retrieval system