KEGG   Ketogulonicigenium vulgare Y25: EIO_2669Help
Entry
EIO_2669          CDS       T01338                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
kvu  Ketogulonicigenium vulgare Y25
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:kvu00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    EIO_2669
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    EIO_2669
Enzymes [BR:kvu01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     EIO_2669
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2577903..2578454
Genome map
AA seq 183 aa AA seqDB search
MIEETSLPGVMIVTPARHGDARGFFSESWNRQRMADAGLVYDFVQDNHSLSMRVGTLRGL
HFQSPPHAQAKLVRCGRGRLFDVAVDIRKGSPTYGKWVGVELSFENGRQLLIPEGFLHGF
VTLEPETEVVYKCTDYYAPDCDGAVLWDSCGIEWPLEGEPLLSDKDLRAVPLSDFDSPFD
FKG
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgattgaagaaacctcgcttcccggcgtgatgattgtaacacccgcacgtcacggcgat
gcacggggatttttctcggaaagctggaaccggcagcgtatggctgatgcgggccttgtt
tatgatttcgtgcaggacaaccactcgctgtcgatgcgagtcggcacgttgcgcgggctg
catttccaatcgcccccccatgcgcaggcgaaactggtgcgctgcgggcgcgggcggctg
tttgatgtggcggtcgatatccgcaagggcagccccacctatggcaaatgggttggggtt
gaactcagctttgaaaacggtcgccaactgctgatccccgaggggttcctgcacggcttc
gtcaccctcgagcctgagaccgaggttgtttacaaatgcaccgattactatgcccccgac
tgcgacggtgcggtgctgtgggatagctgcggcattgaatggccgcttgaaggcgagccg
ctgctatcggacaaggatctgcgcgcggtgccgctttctgattttgattcgccttttgat
ttcaagggataa

DBGET integrated database retrieval system