KEGG   Ketogulonicigenium vulgare Y25: EIO_2680Help
Entry
EIO_2680          CDS       T01338                                 

Definition
(GenBank) uroporphyrinogen-III synthase, putative
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
kvu  Ketogulonicigenium vulgare Y25
Pathway
kvu00860  Porphyrin and chlorophyll metabolism
kvu01100  Metabolic pathways
kvu01110  Biosynthesis of secondary metabolites
kvu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:kvu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    EIO_2680
Enzymes [BR:kvu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     EIO_2680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: ADO43755
UniProt: E3F089
Position
complement(2589436..2590119)
Genome map
AA seq 227 aa AA seqDB search
MAATLLLTRPLGAAQRFLDGLGVETPHLISPIMRIVPLTPQVLRVPKALVLTSENGAAAL
ARLDLPPGLPAWCVGLRTAEVARANGADAIVAGPDAAHLLPRILAEGGNGPFLHLRGAHV
AADVAVALQSAGRVCDALVVYDQQDCPLSPAALALLNGTAPVVLPLFSPRSAALVAKAGP
FAAPLIIVAISPAAAALAPSAAKVYVAPTPELSAMQRLVAQAVGEAG
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atggccgcgacattgctgctgacccgcccgctcggcgcggcccagcgatttttggatggg
ctgggggtcgagacgccccatctgatcagcccgatcatgcggatcgtcccgctgaccccg
caggtgttgcgcgtgccaaaggcgctggtgctgacatcggaaaatggcgcggcggccttg
gcgcgccttgatctgccgcccggcctgcccgcgtggtgtgtcggcctgcgcacagccgag
gttgcccgcgccaatggcgccgatgccatcgtggcaggccccgatgccgcgcatttgctg
ccccgcattctggccgagggcggaaatggcccttttttgcatttgcgcggcgcgcatgtt
gccgcagatgtggccgtggcgctacagtcggcggggcgtgtttgcgatgctttggtggtc
tatgatcagcaggattgcccgctttcacccgccgcccttgcgctattgaatggcacagcg
cctgtggttctgccgctgttttcaccgcgatctgcggctttggtggcgaaagcggggcca
tttgcggccccattgatcatcgtggccatcagcccggctgcggcagcattggcaccatcc
gccgcaaaggtttacgttgcgcccacgcctgaactttcggcaatgcagcgccttgtcgcg
caagccgttggcgaagcgggttga

DBGET integrated database retrieval system