KEGG   Ketogulonicigenium vulgare Y25: EIO_2699Help
Entry
EIO_2699          CDS       T01338                                 

Gene name
gtaB
Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
kvu  Ketogulonicigenium vulgare Y25
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:kvu00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    EIO_2699 (gtaB)
   00052 Galactose metabolism
    EIO_2699 (gtaB)
   00500 Starch and sucrose metabolism
    EIO_2699 (gtaB)
   00520 Amino sugar and nucleotide sugar metabolism
    EIO_2699 (gtaB)
Enzymes [BR:kvu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     EIO_2699 (gtaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2605460..2606434)
Genome map
AA seq 324 aa AA seqDB search
MIAAQKRYNISLTTGTILKNRERFPMRKVRKAVFPVAGLGTRFLPATKAVPKEVLTLVDR
PLIQYAIDEAREAGITDFIFVTARGKSALENYFDQNPELERALLDAGKTKLLEALAPSNM
DSGAIAYVRQHKALGLGHAVACASKLIGDEPFAVILPDDVIAAQPSCLKQMVEAYEEIGN
EGCLVATMEVPDSMISSYGVLDVKAGEGRLVEAKGMVEKPKLGTEPSNLAVIGRYILSPR
VLQNLTEIKPGAGGEIQLTDAIAAEFAKGGKVCGYRFDGQRFDCGSKAGFLQATVHFGLN
HPELREELADYLRHIVNDELGATV
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
ttgattgccgcacaaaagcgttacaacattagcctgacaacaggcacgattttaaagaac
agagagagatttccaatgaggaaagttcgcaaagctgtattccccgtcgcaggtctgggt
acccgttttctgcccgctaccaaggccgtgccaaaggaagttctgacgctggttgaccgc
cccttgatccaatatgcgatcgacgaggcccgcgaggccggtattaccgatttcatcttc
gtcactgcgcgcggtaaatctgcgctggaaaactacttcgaccagaaccctgaacttgag
cgcgccctgctggacgccggtaaaaccaagctgcttgaggcgctggcccccagcaatatg
gacagcggcgccattgcctatgtgcgccagcacaaggcgctaggtctgggtcatgcggtt
gcctgtgcgtccaagctgatcggggacgagccctttgccgttatcctgcctgatgatgtg
atcgcggcgcagccctcgtgcctcaagcagatggtcgaagcctatgaagagatcggcaat
gaaggctgcctcgttgcgacgatggaagtgcccgattcgatgatctcttcctatggcgtg
ttggatgtgaaagctggcgagggccgtctggtcgaggccaagggcatggttgaaaagcca
aagctgggcaccgagccgtcgaaccttgcggtgatcggccgttatatcctgtcgccgcgt
gttttgcagaacctgaccgagatcaaacccggcgcaggtggcgagattcaattgaccgac
gccattgccgccgaattcgccaaaggtggcaaggtctgcggttaccgtttcgatggtcag
cgctttgactgcggatcgaaagcgggtttcttgcaggcgacggtgcatttcggcctgaac
catcccgagctgcgcgaagagctggctgattacctgcgccacatcgtgaacgacgaactt
ggtgcaacggtctga

DBGET integrated database retrieval system