KEGG   Ketogulonicigenium vulgare Y25: EIO_2701Help
Entry
EIO_2701          CDS       T01338                                 

Definition
3'-phosphadenosine 5'-phosphosulfate 3'-phosphatase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
kvu  Ketogulonicigenium vulgare Y25
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:kvu00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    EIO_2701
Enzymes [BR:kvu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     EIO_2701
Transfer RNA biogenesis [BR:kvu03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    EIO_2701
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2607283..2608074)
Genome map
AA seq 263 aa AA seqDB search
MNFETLTQQMRSLALQAGAEILRIYEGEDLGVSLKSDESPVTAADEAADKVIAAGLRAAF
PDVALVTEEQSATHGQSLSTFLIVDPLDGTKEFIQRRGDFTVNIAYVKDGVPVRGVVYAP
AKGRLFYTQADGTSVEEIGPFGDTPGPVQALTVSTPDNAALMVVASKSHRDQATDDYIAK
YAVRDMTSAGSSLKFCLVATGEADLYPRLGRTMEWDTAAGDAVLRGAGGTVLNFDDHSPL
TYGKAGFANPFFIAAAPGVELKA
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
gtgaactttgagacgctgacgcaacagatgcgcagccttgctttgcaagcaggtgccgaa
attctccgcatttacgagggtgaagatctgggcgttagccttaaatccgacgaaagtccc
gtaaccgccgcggatgaagctgccgataaagtgatcgcggcgggcctgcgtgccgccttt
ccagacgttgcgctggtcactgaagagcaatccgcgacgcatggtcaaagtttaagcaca
ttcctgatcgtcgatccgctggatggtacgaaagagtttattcagcgtcgcggcgatttc
acggtgaatattgcctatgtgaaagacggcgtgccagtgcgcggtgtggtctatgcgccc
gcgaaaggccgcctgttttatacgcaggccgatggcacttcggtcgaggaaatcggcccc
ttcggcgatacgccgggcccggtgcaggcgctgacggtttcgacgcctgataatgcggcg
ctgatggttgttgcgtcgaaatcgcaccgcgatcaggcgaccgatgattacatcgcgaaa
tacgccgtgcgcgatatgaccagcgccggatcatcgctgaaattctgccttgtcgcgacc
ggcgaggctgatctttacccccgtctaggccgcaccatggaatgggatacggcggcgggg
gatgctgtgttgcgcggtgcgggcggcactgtgctgaactttgacgatcacagcccgctg
acctatggcaaggccggtttcgccaatccctttttcattgccgctgcccccggtgtcgag
ctgaaagcctga

DBGET integrated database retrieval system