KEGG   Ketogulonicigenium vulgare Y25: EIO_2742Help
Entry
EIO_2742          CDS       T01338                                 

Gene name
rbsK
Definition
(GenBank) ribokinase
  KO
K00852  ribokinase [EC:2.7.1.15]
Organism
kvu  Ketogulonicigenium vulgare Y25
Pathway
kvu00030  Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:kvu00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    EIO_2742 (rbsK)
Enzymes [BR:kvu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     EIO_2742 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin
Motif
Other DBs
NCBI-ProteinID: ADO43816
UniProt: E3F132
Position
complement(2647031..2647897)
Genome map
AA seq 288 aa AA seqDB search
MTIWNLGSINVDNTYALHHIVAPGETIVASNLLTGLGGKGANMSVAMSRAGGKVVHIGAV
GRDLDWPVARLAEYGVDTGFIATVDEATGHAIITVDRSGENAIIVYSGANNAVPLEVLKA
ALAEAKIGDRFVMQNETNNQAEAARLARAAGLWVAYAAAPFSAAAVEAVLPHIDFLILNE
VEAAQLQEATGKAPQDLGVRDVIVTLGGDGAAWYGEDGVQKFPAIKVTPVDTTGAGDTVT
GYIIAGLDNGLLMPEAINQAMKAGALMVMRHGTADVIPKLPEVQTFSV
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgacaatctggaatttggggtcgatcaacgtcgacaacacctatgcgctgcatcatatc
gtagcgcccggcgagacgatcgtggccagcaacctgctgaccggactgggcggcaagggc
gcgaatatgtcggttgcgatgtcgcgcgcgggcggcaaggttgtccatatcggcgcggtt
ggtcgcgatctggattggccggtggcacgccttgccgaatatggcgtcgatacgggtttt
atcgccacggtggacgaggcgacgggccatgcgatcatcacggtcgaccgctcgggcgaa
aacgcgatcatcgtctattcgggtgcgaataatgccgtcccccttgaggtgctaaaggcc
gcgctggccgaggcgaagatcggtgaccgttttgtcatgcagaacgagaccaataatcag
gccgaggccgcacgtctggcccgcgcggccggtctgtgggttgcctatgccgctgcgccc
tttagcgcggctgcagtcgaggctgtcctgccccatatcgactttctcatcctgaacgag
gtcgaggccgcgcagctacaagaggccaccggcaaagcgccgcaagatctgggcgtgcgc
gatgtgatcgtcactttgggcggcgatggtgccgcctggtatggcgaggatggcgtgcaa
aagtttcccgccatcaaagtcacccccgtggataccaccggcgcgggcgatacggtcacc
ggctatattatcgcgggcctcgacaatggtttgctgatgcccgaggcgatcaatcaggcg
atgaaagcgggcgcgttaatggtcatgcgccatggcacagccgatgtgatcccgaaactg
ccggaagttcagactttttcggtttga

DBGET integrated database retrieval system